LOADING...
   YP_193882.1;GD9765C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_193882.1    Target Constructs

Accession: YP_193882.1
Local acc: GD9765C
Description: gi|58337297|ref|YP_193882.1| putative trp repressor binding protein [Lactobacillus acidophilus NCFM]
Organism: Lactobacillus acidophilus NCFM
Residues: 150 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>GD9765C|1:150 tid:388454 alias: stage:pdb deposition(pdb id:3EDO) Full|1:150 CP Pir/Fasta
MAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADMYKTSDIALDQIQGN
KDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTSAGTNHK
AYVSHFNEWADGLNVIGVARDDSEVDKWSK
CDS  cDNA 450 bp
   1 atggctaaaa aaacattaat tttatattat tcttggtctg gtgaaaccaa gaaaatggcg    60
  61 gaaaagatca atagtgaaat taaagatagc gagctcaaag aagtaaaagt atctgaagga   120
 121 acttttgatg ctgatatgta taagacttca gatatcgcat tagatcaaat tcaaggaaat   180
 181 aaggattttc cagaaatcca attagataat atagattata ataattatga tttaatctta   240
 241 attggtagtc cagtttggtc aggctatcct gcaactccaa tcaaaacttt acttgatcaa   300
 301 atgaagaatt atagaggcga agttgcatca ttctttactt cagctggaac aaatcataaa   360
 361 gcatatgtta gtcactttaa tgaatgggca gatggtttga atgttattgg tgtggctaga   420
 421 gatgatagtg aagttgataa atggagtaaa   450

Residues: 150 aa
Molecule Weight: 17002.15 Dalton
Number of Met residues: 4
Percentage of Met residues: 2.67 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu