LOADING...
   YP_098753.1;SP13297E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_098753.1    Target Constructs

Accession: YP_098753.1
Local acc: SP13297E
Description: gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
Organism: Bacteroides fragilis YCH46
Residues: 130 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13297E|22:130 tid:418300 alias: stage:pdb deposition(pdb id:4OUQ) fragment|22:130 CP Pir/Fasta
QDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFN
VNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTNE
CDS  cDNA 327 bp
   1 caggacatac cggtgggcgt ggtcgttgcg tttaagaaag gaaactccca agagctgaac    60
  61 aggtatttgg gagagaaggt gaatctggtg attcagaatc gctcggagag tgtagacagg   120
 121 caggcagctg aaggaacact tgccgctttt ttcagtagca ataaggtcag tggttttaat   180
 181 gtaaaccatg aaggtaagcg ggatgaatcg agttttatta tcggtaccct gaccactgcc   240
 241 aacggcaatt tccggataaa ctgcttcttc cgcagagtac agaacaaata tttaataaat   300
 301 caaataagaa tagataaaac caatgaa   327

Residues: 109 aa
Molecule Weight: 12282.18 Dalton
Number of Met residues: 0
Percentage of Met residues: 0.00 %
Number of Cys residues: 1
Percentage of Cys residues: 0.92 %

>SP13297E|1:130 tid:407827 alias: stage:proposed target Full|1:130 CP Pir/Fasta MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVD RQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLI NQIRIDKTNE CDS cDNA 390 bp 1 atgaaaaaac gggtactttt atggatggcc ggactcgtat tcgctgtaac ttcgctcttc 60 61 gcacaggaca taccggtggg cgtggtcgtt gcgtttaaga aaggaaactc ccaagagctg 120 121 aacaggtatt tgggagagaa ggtgaatctg gtgattcaga atcgctcgga gagtgtagac 180 181 aggcaggcag ctgaaggaac acttgccgct tttttcagta gcaataaggt cagtggtttt 240 241 aatgtaaacc atgaaggtaa gcgggatgaa tcgagtttta ttatcggtac cctgaccact 300 301 gccaacggca atttccggat aaactgcttc ttccgcagag tacagaacaa atatttaata 360 361 aatcaaataa gaatagataa aaccaatgaa 390 Residues: 130 aa Molecule Weight: 14646.05 Dalton Number of Met residues: 2 Percentage of Met residues: 1.54 % Number of Cys residues: 1 Percentage of Cys residues: 0.77 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu