LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095136.1    Target Constructs

Accession: YP_095136.1
Local acc: SP19086A
Description: gi|52841337|ref|YP_095136.1| hypothetical protein lpg1103 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Organism: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
Residues: 403 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP19086A|28:403 tid:418740 alias: stage:pdb deposition(pdb id:4EZI) fragment|28:403 CP Pir/Fasta
ALEHEKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIAS
GLVAMPIHPVGQVGIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGL
GDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTIVMFEM
LAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDE
IFAPPYNTLIPELMDGYHAVDEILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNH
YDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKE
QVDFFKQFERQEAMNK
CDS  cDNA 1128 bp
   1 gctctggagc atgagaagct ggttaattat attgctttgg gtgaattttc cagggaaaca    60
  61 gcagaaatcg ctttaaaaaa aatgccgcca ttagacaccc ttacagtaca ttatgatctg   120
 121 caattatata aaattaatta taaaacccag tcaccagatg gaaatctgac tattgcctca   180
 181 ggattagttg caatgccaat tcatcctgtg gggcaagtgg gaattattag ctatcagcat   240
 241 ggcacccgat ttgaacgcaa tgatgtacct tccagaaata atgaaaaaaa ctatatatac   300
 301 cttgctgcct atggtaatag tgcaggttat atgacggtga tgccagatta tcttggtctg   360
 361 ggagataatg aattaacact ccacccttat gttcaggcag aaactcttgc cagcagtagc   420
 421 attgatatgt tgtttgctgc taaggagtta gccaacaggc ttcattaccc aataagcgat   480
 481 aaattatatc tggcaggtta ttcagaaggc ggattctcaa ctattgtaat gtttgaaatg   540
 541 ctggcaaaag agtatcctga tttacctgtc tctgcggttg ccccaggttc agctccttat   600
 601 ggctgggaag aaaccatgca ttttgtgatg ttggaaccag gacctcgtgc tacagcctat   660
 661 ttggcctatt tcttttattc tctgcaaact tataagagtt attggtctgg ttttgacgaa   720
 721 atttttgctc ctccttacaa tactcttatc ccggaattga tggatggata tcatgctgtt   780
 781 gacgaaattc ttcaagcctt accacaagat ccgctgctta tttttcagcc aaaattctct   840
 841 aatggaatta ttagtaagac agatagaaat accgagattt taaaaattaa ttttaaccac   900
 901 tatgatttta aacctacagc tcctttgtta ttggttggca ctaaaggtga tcgtgatgta   960
 961 ccttatgcag gagctgaaat ggcatatcat tcctttagga aatatagtga ttttgtgtgg  1020
1021 ataaaatccg tcagtgacgc attggatcat gtgcaagctc atccctttgt actcaaagaa  1080
1081 caggtggatt tttttaaaca atttgagcgt caagaagcaa tgaataaa  1128

Residues: 376 aa
Molecule Weight: 42602.21 Dalton
Number of Met residues: 12
Percentage of Met residues: 3.19 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP19086A|1:403 tid:412156 alias: stage:proposed target Full|1:403 CP Pir/Fasta MVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETAEIALKKMPPLDT LTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHGTRFERNDVPSRN NEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANR LHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEP GPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLL IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFR KYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK CDS cDNA 1209 bp 1 atggttatga aaacgatgcg tttattcaaa gggattcttt ttacattttg cgggattatt 60 61 ttttgcttta attcccatgc tgctctggag catgagaagc tggttaatta tattgctttg 120 121 ggtgaatttt ccagggaaac agcagaaatc gctttaaaaa aaatgccgcc attagacacc 180 181 cttacagtac attatgatct gcaattatat aaaattaatt ataaaaccca gtcaccagat 240 241 ggaaatctga ctattgcctc aggattagtt gcaatgccaa ttcatcctgt ggggcaagtg 300 301 ggaattatta gctatcagca tggcacccga tttgaacgca atgatgtacc ttccagaaat 360 361 aatgaaaaaa actatatata ccttgctgcc tatggtaata gtgcaggtta tatgacggtg 420 421 atgccagatt atcttggtct gggagataat gaattaacac tccaccctta tgttcaggca 480 481 gaaactcttg ccagcagtag cattgatatg ttgtttgctg ctaaggagtt agccaacagg 540 541 cttcattacc caataagcga taaattatat ctggcaggtt attcagaagg cggattctca 600 601 actattgtaa tgtttgaaat gctggcaaaa gagtatcctg atttacctgt ctctgcggtt 660 661 gccccaggtt cagctcctta tggctgggaa gaaaccatgc attttgtgat gttggaacca 720 721 ggacctcgtg ctacagccta tttggcctat ttcttttatt ctctgcaaac ttataagagt 780 781 tattggtctg gttttgacga aatttttgct cctccttaca atactcttat cccggaattg 840 841 atggatggat atcatgctgt tgacgaaatt cttcaagcct taccacaaga tccgctgctt 900 901 atttttcagc caaaattctc taatggaatt attagtaaga cagatagaaa taccgagatt 960 961 ttaaaaatta attttaacca ctatgatttt aaacctacag ctcctttgtt attggttggc 1020 1021 actaaaggtg atcgtgatgt accttatgca ggagctgaaa tggcatatca ttcctttagg 1080 1081 aaatatagtg attttgtgtg gataaaatcc gtcagtgacg cattggatca tgtgcaagct 1140 1141 catccctttg tactcaaaga acaggtggat ttttttaaac aatttgagcg tcaagaagca 1200 1201 atgaataaa 1209 Residues: 403 aa Molecule Weight: 45740.97 Dalton Number of Met residues: 15 Percentage of Met residues: 3.72 % Number of Cys residues: 2 Percentage of Cys residues: 0.50 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu