LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094990.1    Target Constructs

Accession: YP_094990.1
Local acc: SP19432A
Description: gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Organism: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
Residues: 392 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP19432A|20:392 tid:418834 alias: stage:pdb deposition(pdb id:4KH9) fragment|20:392 CP Pir/Fasta
FTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISNVRRSYGYKERISLEQLQRG
VIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKH
QAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKA
TISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELNDRGENWYLE
TDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLTFVVTVDVATASRYALQSVL
FQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDDNLYLGYLRLIDYGQLKTVY
QYNQPVKLSQLVD
CDS  cDNA 1119 bp
   1 tttacattac caagacagcc aaccaaagct tatgaatgtg agaattgcag ccaattatca    60
  61 cgagaaaacc tgcacgataa atgggaaatt accaatgaac cattaaacaa caacatcagt   120
 121 aatgttcgta gaagttatgg ttacaaagaa cgtatttctc tggaacaatt acaacgcgga   180
 181 gttattatat caacattggc tcctggcgct gtcgttcgca ttaccccttt gcaaaataaa   240
 241 tccatcccgg aattacttat caaaacgcca aaaaaccaac tcctgcccct gaaagaagcc   300
 301 tcttctctct ataatcagga tgacgaggtt ggcaataatc ctttagccat tacaaaacac   360
 361 caggctatgt tacaaataaa acctgaactg gggtacggaa aatttatact aaaaagcaag   420
 421 gacattacta acaaatatgc cgatgcttat atgattagtg tccttgataa attttccatc   480
 481 acttacctgg aggttgaaac cgattctctc cattaccagt atggggataa gctaaaagcg   540
 541 accatatcgc ttcacaatga tatcactgag tatgacgtca atgacgttga tgctcgactt   600
 601 gtaggcccta aaggtcaagt catttcgctt aatctgacca agttaaaatc caatgtattt   660
 661 gaaggaactg ccactttgga ttctgagtta aatgatcgcg gcgaaaactg gtacttagaa   720
 721 actgatgttc aaacagaata cgggcaagaa atcattagac gatctggcca tacagccttt   780
 781 tcatactcca ttccctcagc cagtcttatg aatgtaaaaa aattgtcctc taaacctttg   840
 841 acttttgttg tcactgtaga tgttgcaact gcaagccgat acgctttaca aagtgtgttg   900
 901 ttccaaaaaa atggaaaggg tgaagccagg cctattcaga cctcgcaaag agcgcagtgg   960
 961 cttgaacccg gtaagcatgt tttgcaattt acctttgaca atcacaatca attatcggac  1020
1021 gataacctct atctgggtta tttacgcttg atagactatg ggcagttaaa aactgtgtat  1080
1081 caatacaacc aacctgtcaa gcttagtcag ttagtggat  1119

Residues: 373 aa
Molecule Weight: 42384.79 Dalton
Number of Met residues: 3
Percentage of Met residues: 0.80 %
Number of Cys residues: 2
Percentage of Cys residues: 0.54 %

>SP19432A|1:392 tid:412258 alias: stage:proposed target Full|1:392 CP Pir/Fasta MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISN VRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEAS SLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSIT YLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFE GTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDD NLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD CDS cDNA 1176 bp 1 atgaaaactg cccatcttat atggatatcc gcattttgta ttgcccaagc tcatgcgttt 60 61 acattaccaa gacagccaac caaagcttat gaatgtgaga attgcagcca attatcacga 120 121 gaaaacctgc acgataaatg ggaaattacc aatgaaccat taaacaacaa catcagtaat 180 181 gttcgtagaa gttatggtta caaagaacgt atttctctgg aacaattaca acgcggagtt 240 241 attatatcaa cattggctcc tggcgctgtc gttcgcatta cccctttgca aaataaatcc 300 301 atcccggaat tacttatcaa aacgccaaaa aaccaactcc tgcccctgaa agaagcctct 360 361 tctctctata atcaggatga cgaggttggc aataatcctt tagccattac aaaacaccag 420 421 gctatgttac aaataaaacc tgaactgggg tacggaaaat ttatactaaa aagcaaggac 480 481 attactaaca aatatgccga tgcttatatg attagtgtcc ttgataaatt ttccatcact 540 541 tacctggagg ttgaaaccga ttctctccat taccagtatg gggataagct aaaagcgacc 600 601 atatcgcttc acaatgatat cactgagtat gacgtcaatg acgttgatgc tcgacttgta 660 661 ggccctaaag gtcaagtcat ttcgcttaat ctgaccaagt taaaatccaa tgtatttgaa 720 721 ggaactgcca ctttggattc tgagttaaat gatcgcggcg aaaactggta cttagaaact 780 781 gatgttcaaa cagaatacgg gcaagaaatc attagacgat ctggccatac agccttttca 840 841 tactccattc cctcagccag tcttatgaat gtaaaaaaat tgtcctctaa acctttgact 900 901 tttgttgtca ctgtagatgt tgcaactgca agccgatacg ctttacaaag tgtgttgttc 960 961 caaaaaaatg gaaagggtga agccaggcct attcagacct cgcaaagagc gcagtggctt 1020 1021 gaacccggta agcatgtttt gcaatttacc tttgacaatc acaatcaatt atcggacgat 1080 1081 aacctctatc tgggttattt acgcttgata gactatgggc agttaaaaac tgtgtatcaa 1140 1141 tacaaccaac ctgtcaagct tagtcagtta gtggat 1176 Residues: 392 aa Molecule Weight: 44479.19 Dalton Number of Met residues: 4 Percentage of Met residues: 1.02 % Number of Cys residues: 3 Percentage of Cys residues: 0.77 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu