LOADING...
   YP_001714229.1;SP2417A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714229.1    Target Constructs

Accession: YP_001714229.1
Local acc: SP2417A
Description: gi|169796436|ref|YP_001714229.1| ankyrin repeat-containing protein [Acinetobacter baumannii AYE]
Organism: Acinetobacter baumannii AYE
Residues: 236 aa
Constructs: 2
Warning: the change of start codon from ATG/M to GTG/V(see CP);
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP2417A|40:236 tid:420360 alias: stage:pdb deposition(pdb id:5D66) fragment|40:236 CP Pir/Fasta
KDEYPLHMAAANDDIQLIKHILSQKTLIDARDETGSTALMVATRANNIHAAHMLIEAGAD
VNAKDNIQDSPYLYAGAQGYLKILRMTLMHGADLKSTNRYGGTALIPAAERGHVETVRTL
IAAGVNVNHVNNLGWTALLEAIILGNGKSNYQQIVALLLKAGANPNLADKDGITPLQHAR
TRGYREIEKLLLVAGAK
CDS  cDNA 591 bp
   1 aaagatgaat accctttaca catggcagct gcaaatgacg atattcagtt aataaaacat    60
  61 attttgtctc aaaagacctt aattgatgca cgtgatgaaa caggttcaac agcattaatg   120
 121 gtggcaacaa gagcaaacaa tatacatgct gctcatatgt tgattgaggc cggcgcagat   180
 181 gtaaatgcga aagataatat acaagatagt ccttatttgt atgcaggcgc acaaggttat   240
 241 ttaaaaattt tacgaatgac actcatgcat ggtgccgatt taaagagtac taaccgttat   300
 301 gggggaaccg cgcttattcc agcagcagaa cggggccatg tagaaactgt ccgtacttta   360
 361 attgccgcag gtgtaaacgt aaatcatgtc aataatttag gttggacagc tttactagaa   420
 421 gcaatcattt taggtaatgg caaatccaac tatcagcaaa ttgtggcgct tttgctaaaa   480
 481 gctggtgcca atccgaattt ggcagataaa gatgggatca caccattaca acatgcacgt   540
 541 acaagaggat atcgcgaaat tgaaaaactc cttcttgtag caggtgcaaa a   591

Residues: 197 aa
Molecule Weight: 21234.15 Dalton
Number of Met residues: 5
Percentage of Met residues: 2.54 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP2417A|1:236 tid:406340 alias: stage:proposed target Full|1:236 CP Pir/Fasta VPNCYAIHFYLECFMRKSLIWINLIIAMGALGFTNAVNAKDEYPLHMAAANDDIQLIKHI LSQKTLIDARDETGSTALMVATRANNIHAAHMLIEAGADVNAKDNIQDSPYLYAGAQGYL KILRMTLMHGADLKSTNRYGGTALIPAAERGHVETVRTLIAAGVNVNHVNNLGWTALLEA IILGNGKSNYQQIVALLLKAGANPNLADKDGITPLQHARTRGYREIEKLLLVAGAK CDS cDNA 708 bp 1 gtgccaaatt gttatgcaat tcatttttat ttggagtgtt tcatgcgtaa gtccctcata 60 61 tggatcaatc tgatcattgc gatgggcgct ttgggtttta caaatgcggt aaatgcaaaa 120 121 gatgaatacc ctttacacat ggcagctgca aatgacgata ttcagttaat aaaacatatt 180 181 ttgtctcaaa agaccttaat tgatgcacgt gatgaaacag gttcaacagc attaatggtg 240 241 gcaacaagag caaacaatat acatgctgct catatgttga ttgaggccgg cgcagatgta 300 301 aatgcgaaag ataatataca agatagtcct tatttgtatg caggcgcaca aggttattta 360 361 aaaattttac gaatgacact catgcatggt gccgatttaa agagtactaa ccgttatggg 420 421 ggaaccgcgc ttattccagc agcagaacgg ggccatgtag aaactgtccg tactttaatt 480 481 gccgcaggtg taaacgtaaa tcatgtcaat aatttaggtt ggacagcttt actagaagca 540 541 atcattttag gtaatggcaa atccaactat cagcaaattg tggcgctttt gctaaaagct 600 601 ggtgccaatc cgaatttggc agataaagat gggatcacac cattacaaca tgcacgtaca 660 661 agaggatatc gcgaaattga aaaactcctt cttgtagcag gtgcaaaa 708 Residues: 236 aa Molecule Weight: 25667.25 Dalton Number of Met residues: 8 Percentage of Met residues: 3.39 % Number of Cys residues: 2 Percentage of Cys residues: 0.85 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu