LOADING...
   YP_001635819.1;MI10991B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001635819.1    Target Constructs

Accession: YP_001635819.1
Local acc: MI10991B
Description: caur_25may01_Contig941_revised_gene4220
Organism: CHLOROFLEXUS AURANTIACUS J-10-FL
Residues: 198 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>MI10991B|1:198 tid:399264 alias: stage:pdb deposition(pdb id:3QBM) Full|1:198 CP Pir/Fasta
MRKGQETRERVVAQAAALFNVSGYAGTAISDIMAATGLEKGGIYRHFESKEQLALAAFDY
AAEKVRERFAVGLAGHKHTVDTIIAFLDVFRSYAERPPLVGGCPILNTAIESDDTNPMLR
ERVRAVIDEWRETIRTLVQTGIARGEIRPEVDADRLALLIIATMEGAVMLARILETATPL
EHAYTHLATYITQQVRLA
CDS  cDNA 594 bp
   1 atgcggaagg ggcaggagac ccgcgagcgg gtcgtggcac aggcggcggc gcttttcaat    60
  61 gtttcaggct atgccggcac cgcgatcagt gacattatgg cagcgacggg gctggagaaa   120
 121 ggagggatct accggcattt cgagagtaaa gagcagcttg cgctggctgc gtttgactat   180
 181 gctgctgaga aagtccgtga gcggttcgca gttggtctgg cagggcacaa gcacacagtg   240
 241 gatacgatca tcgcttttct ggatgtcttt cgtagttacg ctgaacgtcc accgctggtc   300
 301 ggcggctgcc cgatactcaa cactgccatc gagagcgatg ataccaaccc gatgttacgt   360
 361 gagcgggtac gtgccgttat tgacgagtgg cgcgagacca tccgaacgct ggtacagacc   420
 421 ggtattgccc gtggcgagat tcgcccggag gttgacgctg accggctggc actgctcatc   480
 481 attgcgacga tggaaggagc agtgatgctt gcccgtattc tggaaaccgc cacgccctta   540
 541 gaacatgcat atacacatct tgccacctat atcacgcagc aggtgcggtt ggcc   594

Residues: 198 aa
Molecule Weight: 21864.87 Dalton
Number of Met residues: 5
Percentage of Met residues: 2.53 %
Number of Cys residues: 1
Percentage of Cys residues: 0.51 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu