LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1    Target Constructs

Accession: YP_001337146.1
Local acc: SP18574A
Description: gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
Organism: Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Residues: 101 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP18574A|26:101 tid:418471 alias: stage:pdb deposition(pdb id:4XVV) fragment|26:101 CP Pir/Fasta
VEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECH
KNPAAKLGDLSAVIKK
CDS  cDNA 228 bp
   1 gttgaggaaa ccacgccgca gaatatgacc tgtcaggaat ttatggatat gaacccaaaa    60
  61 agcatgaccc cggtggcctt ctgggtagtg aatcgcaaca ccgactttag cggcggcgac   120
 121 tatgttgact ggcatgaagt tgagaccgtt tcggtaccga aaatgctgca ggagtgccac   180
 181 aagaaccccg cagctaaact tggcgatctc agcgcggtca tcaaaaaa   228

Residues: 76 aa
Molecule Weight: 8602.39 Dalton
Number of Met residues: 5
Percentage of Met residues: 6.58 %
Number of Cys residues: 2
Percentage of Cys residues: 2.63 %

>SP18574A|1:101 tid:411737 alias: stage:proposed target Full|1:101 CP Pir/Fasta MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK CDS cDNA 303 bp 1 atgaatttac ctaaagcact cgtattgacc gtggcggcta ccacattctg tctgatgacc 60 61 agcccggcgt tcgcggttga ggaaaccacg ccgcagaata tgacctgtca ggaatttatg 120 121 gatatgaacc caaaaagcat gaccccggtg gccttctggg tagtgaatcg caacaccgac 180 181 tttagcggcg gcgactatgt tgactggcat gaagttgaga ccgtttcggt accgaaaatg 240 241 ctgcaggagt gccacaagaa ccccgcagct aaacttggcg atctcagcgc ggtcatcaaa 300 301 aaa 303 Residues: 101 aa Molecule Weight: 11196.41 Dalton Number of Met residues: 7 Percentage of Met residues: 6.93 % Number of Cys residues: 3 Percentage of Cys residues: 2.97 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu