LOADING...
   YP_001305260.1;PX14343H
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305260.1    Target Constructs

Accession: YP_001305260.1
Local acc: PX14343H
Description: gi|150010517|ref|YP_001305260.1| putative outer membrane protein, probably involved in nutrient binding [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
Residues: 506 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>PX14343H|26:506 tid:396627 alias: stage:pdb deposition(pdb id:3OTN) fragment|26:506 CP Pir/Fasta
QPTGTMTTDSKLTSKESALALTNSAYLKNTVFNKMTPGWGCNTILLLEYMTGKATSENSQ
SNYKDFQDLLVSDRSLYIEDWWQDCYAGIANCNLALQKLGEFENLDASLVNGYMAEVKFM
RALYYFYLVRIFGDVPKITTVQSELGELQVSRAPVKEIYDEIIIPDLLEAEQSDLAFSDH
TGRVSMGAVKALLADVYLTYAGYPLQGGKSYYAESAKRSLEVIKSNEYTLFTDYESLRLP
SQNNKGEFIYQVQFSLNKRHNESVRIFLPSRSGISAYDLEYGSLIPTKEFVESFEKGDKR
TEEKQYFFTNYKGHPSKFSPGAAELEFMDLNGYYIYKFFDQVAVDNTAKSDLNWSVYRYT
DVLLMYAEAQVNADGTPNQQSIDIVNQIRGRAGLAPFKQTNASAFLEEVWDQRYFDLCYE
NKMWFDMLRTRKIRDDKSGEYVDFIGYKTNWGKVYTETQLLFPIPLSERQANPNLTQNQG
Y
CDS  cDNA 1443 bp
   1 cagcctaccg gtacgatgac taccgattca aagttgacaa gtaaggagtc cgctttggcc    60
  61 ttgacgaatt cggcttattt gaagaatacg gtctttaata agatgacccc gggttgggga   120
 121 tgtaatacga tcttattgct cgaatatatg actggcaaag ctacttccga gaattcccaa   180
 181 tcgaattata aggactttca ggatctactg gtgagtgatc gttctttata tatcgaggac   240
 241 tggtggcaag attgttatgc aggtatagcg aactgtaacc tcgcgcttca aaaactcggg   300
 301 gagttcgaga atctggatgc ttccttggtt aatggctaca tggccgaggt gaagtttatg   360
 361 agggctttgt attatttcta tttggtacgt atctttggcg atgtccctaa gattacgacc   420
 421 gtacagtcgg agttgggaga gctgcaagta tctcgtgccc cggtaaagga aatctatgat   480
 481 gagatcatta ttccggattt gttggaggcc gagcaatcgg atctggcttt tagcgatcat   540
 541 acagggcgtg tctcgatggg agcggtgaaa gcgcttcttg cggatgtcta tcttacgtat   600
 601 gccggttatc ctttgcaagg aggtaaatct tattacgcgg aatcggctaa acgttcattg   660
 661 gaggttataa aatcgaatga gtatacgctc ttcacggatt atgagagcct acggcttccg   720
 721 tcgcagaata ataagggaga gtttatttat caagttcagt tctccttgaa caagcggcat   780
 781 aacgagtcgg tacgtatctt tttaccttct cgttccggca tttccgccta cgatttggaa   840
 841 tatggtagcc tgatccctac caaggagttc gtggaaagct ttgagaaagg agataagcgt   900
 901 acggaagaga agcaatattt ctttacgaac tacaaggggc atccgagtaa gttctctccg   960
 961 ggagcggcag agttggagtt tatggatttg aatggctatt atatctataa gttttttgat  1020
1021 caagtagctg ttgataatac ggcgaagtcg gacttgaact ggagtgtata tcgttacacg  1080
1081 gatgtattat taatgtatgc ggaagcgcaa gtgaatgcgg atggtactcc gaaccagcaa  1140
1141 tccatcgata ttgtgaacca aatacgagga agggccggat tagcgccgtt caagcagacc  1200
1201 aacgcaagcg cattcttgga ggaagtctgg gaccaacgtt actttgacct atgttatgag  1260
1261 aataagatgt ggtttgatat gctacgcacc cgtaagatcc gggatgataa atccggggaa  1320
1321 tatgtggact ttatcggcta taagacgaat tggggtaagg tgtatacgga aacccagcta  1380
1381 ttgttcccga ttccattaag cgaacggcag gcgaatccga acctgactca gaatcaaggt  1440
1441 tat  1443

Residues: 481 aa
Molecule Weight: 55158.13 Dalton
Number of Met residues: 10
Percentage of Met residues: 2.08 %
Number of Cys residues: 4
Percentage of Cys residues: 0.83 %

>PX14343H|1:506 tid:396103 alias: stage:proposed target Full|1:506 CP Pir/Fasta MKINKIYIVSLCALFLSSCNNFLDEQPTGTMTTDSKLTSKESALALTNSAYLKNTVFNKM TPGWGCNTILLLEYMTGKATSENSQSNYKDFQDLLVSDRSLYIEDWWQDCYAGIANCNLA LQKLGEFENLDASLVNGYMAEVKFMRALYYFYLVRIFGDVPKITTVQSELGELQVSRAPV KEIYDEIIIPDLLEAEQSDLAFSDHTGRVSMGAVKALLADVYLTYAGYPLQGGKSYYAES AKRSLEVIKSNEYTLFTDYESLRLPSQNNKGEFIYQVQFSLNKRHNESVRIFLPSRSGIS AYDLEYGSLIPTKEFVESFEKGDKRTEEKQYFFTNYKGHPSKFSPGAAELEFMDLNGYYI YKFFDQVAVDNTAKSDLNWSVYRYTDVLLMYAEAQVNADGTPNQQSIDIVNQIRGRAGLA PFKQTNASAFLEEVWDQRYFDLCYENKMWFDMLRTRKIRDDKSGEYVDFIGYKTNWGKVY TETQLLFPIPLSERQANPNLTQNQGY CDS cDNA 1518 bp 1 atgaaaataa ataaaatcta tatcgtctca ttatgtgcgt tattcttgtc ttcttgtaat 60 61 aatttcttgg acgagcagcc taccggtacg atgactaccg attcaaagtt gacaagtaag 120 121 gagtccgctt tggccttgac gaattcggct tatttgaaga atacggtctt taataagatg 180 181 accccgggtt ggggatgtaa tacgatctta ttgctcgaat atatgactgg caaagctact 240 241 tccgagaatt cccaatcgaa ttataaggac tttcaggatc tactggtgag tgatcgttct 300 301 ttatatatcg aggactggtg gcaagattgt tatgcaggta tagcgaactg taacctcgcg 360 361 cttcaaaaac tcggggagtt cgagaatctg gatgcttcct tggttaatgg ctacatggcc 420 421 gaggtgaagt ttatgagggc tttgtattat ttctatttgg tacgtatctt tggcgatgtc 480 481 cctaagatta cgaccgtaca gtcggagttg ggagagctgc aagtatctcg tgccccggta 540 541 aaggaaatct atgatgagat cattattccg gatttgttgg aggccgagca atcggatctg 600 601 gcttttagcg atcatacagg gcgtgtctcg atgggagcgg tgaaagcgct tcttgcggat 660 661 gtctatctta cgtatgccgg ttatcctttg caaggaggta aatcttatta cgcggaatcg 720 721 gctaaacgtt cattggaggt tataaaatcg aatgagtata cgctcttcac ggattatgag 780 781 agcctacggc ttccgtcgca gaataataag ggagagttta tttatcaagt tcagttctcc 840 841 ttgaacaagc ggcataacga gtcggtacgt atctttttac cttctcgttc cggcatttcc 900 901 gcctacgatt tggaatatgg tagcctgatc cctaccaagg agttcgtgga aagctttgag 960 961 aaaggagata agcgtacgga agagaagcaa tatttcttta cgaactacaa ggggcatccg 1020 1021 agtaagttct ctccgggagc ggcagagttg gagtttatgg atttgaatgg ctattatatc 1080 1081 tataagtttt ttgatcaagt agctgttgat aatacggcga agtcggactt gaactggagt 1140 1141 gtatatcgtt acacggatgt attattaatg tatgcggaag cgcaagtgaa tgcggatggt 1200 1201 actccgaacc agcaatccat cgatattgtg aaccaaatac gaggaagggc cggattagcg 1260 1261 ccgttcaagc agaccaacgc aagcgcattc ttggaggaag tctgggacca acgttacttt 1320 1321 gacctatgtt atgagaataa gatgtggttt gatatgctac gcacccgtaa gatccgggat 1380 1381 gataaatccg gggaatatgt ggactttatc ggctataaga cgaattgggg taaggtgtat 1440 1441 acggaaaccc agctattgtt cccgattcca ttaagcgaac ggcaggcgaa tccgaacctg 1500 1501 actcagaatc aaggttat 1518 Residues: 506 aa Molecule Weight: 58019.38 Dalton Number of Met residues: 11 Percentage of Met residues: 2.17 % Number of Cys residues: 6 Percentage of Cys residues: 1.19 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu