LOADING...
   YP_001304549.1;SP13991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304549.1    Target Constructs

Accession: YP_001304549.1
Local acc: SP13991A
Description: gi|150009806|ref|YP_001304549.1| hypothetical protein BDI_3222 [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
Residues: 136 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13991A|29:136 tid:418938 alias: stage:pdb deposition(pdb id:4R03) fragment|29:136 CP Pir/Fasta
KDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVP
FYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS
CDS  cDNA 324 bp
   1 aaagattatc tatatgatac aaaagaggag aatggtaaga ttatctctaa agtggtattc    60
  61 ttacaggaaa acggactgtt gaacaaacag gtaagatatg agttccagta caacgagaac   120
 121 ggcaaggttt ccgagaagaa agcgtttcgt tgggatcgga caaacgatga atgggttcca   180
 181 ttctatcaga tcacttatca atatgatgat caaagtggag agataaagac aaattacggt   240
 241 atgtgggata agaaaaagaa aaactttagc ttaaatgtcc agaacatgat tatcccgagt   300
 301 actaattacg aagaaatttt ctca   324

Residues: 108 aa
Molecule Weight: 13105.04 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.85 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP13991A|1:136 tid:412657 alias: stage:proposed target Full|1:136 CP Pir/Fasta MKTSVWGKSILALVFTFMCSLAISAASPKDYLYDTKEENGKIISKVVFLQENGLLNKQVR YEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLN VQNMIIPSTNYEEIFS CDS cDNA 408 bp 1 atgaagacat cagtttgggg taaaagtatt cttgcgcttg tttttacttt catgtgtagt 60 61 ttagcgataa gcgcagcgtc tcctaaagat tatctatatg atacaaaaga ggagaatggt 120 121 aagattatct ctaaagtggt attcttacag gaaaacggac tgttgaacaa acaggtaaga 180 181 tatgagttcc agtacaacga gaacggcaag gtttccgaga agaaagcgtt tcgttgggat 240 241 cggacaaacg atgaatgggt tccattctat cagatcactt atcaatatga tgatcaaagt 300 301 ggagagataa agacaaatta cggtatgtgg gataagaaaa agaaaaactt tagcttaaat 360 361 gtccagaaca tgattatccc gagtactaat tacgaagaaa ttttctca 408 Residues: 136 aa Molecule Weight: 16047.44 Dalton Number of Met residues: 4 Percentage of Met residues: 2.94 % Number of Cys residues: 1 Percentage of Cys residues: 0.74 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu