LOADING...
   YP_001304276.1;SP16569N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304276.1    Target Constructs

Accession: YP_001304276.1
Local acc: SP16569N
Description: gi|150009533|ref|YP_001304276.1| glycoside hydrolase family 33, candidate sialidase [Parabacteroides distasonis ATCC 8503]
Organism: Parabacteroides distasonis ATCC 8503
Residues: 541 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP16569N|20:541 tid:419091 alias: stage:pdb deposition(pdb id:4FJ6) fragment|20:541 CP Pir/Fasta
ADSIYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEITIQIGDNVDLSDIQAIRLFYSG
VEAPSRKGEHFSPVTYISSHIPGNTRKALESYSVRQDEVTAPLSRTVKLTSKQPMLKGIN
YFWVSIQMKPETSLLAKVATTMPNAQINNKPINITWKGKVDERHVGIGVRQAGDDGSAAF
RIPGLVTTNNGTLLGVYDIRYNSSVDLQEKIDIGVSRSTDKGQTWEPMRVAMTFKQTDGL
PHGQNGVGDPSILVDEKTNTIWVVAAWTHGMGNERAWWNSMPGMTPDETAQLMLVKSEDD
GKTWSEPINITSQVKDPSWYFLLQGPGRGITMQDGTLVFPIQFIDATRVPNAGIMYSKDR
GKTWHLHNLARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAVATTKDLGKTWTEHPSSRSA
LQESVCMASLIKVNAKDNITGKDLLLFSNPNTTKGRNHITIKASLDGGLTWPTEHQVLLD
EAEGWGYSCLSMIDKETVGIFYESSVAHMTFQAVKLQDLIHQ
CDS  cDNA 1566 bp
   1 gcagacagta tttatgtgcg agagcaacaa atccccatct tgatagaccg gatcgacaat    60
  61 gtactttacg agatgcggat accggcccaa aaaggggatg tattaaacga gatcacgata   120
 121 cagatcggag acaatgtcga cctgtcggac atccaagcga tacgtctatt ttatagcgga   180
 181 gtggaagctc cttcccgcaa aggggaacat ttcagtcccg ttacgtacat atccagccat   240
 241 ataccgggaa atacccgtaa ggctcttgaa tcttattccg tacggcaaga tgaggttacc   300
 301 gcccccttgt cgcgcacggt aaaactaacc tctaagcaac cgatgcttaa aggcatcaac   360
 361 tatttctggg taagtatcca gatgaagcct gagacttcct tattggcaaa agtagcgacc   420
 421 acgatgccta acgcccagat caacaacaaa ccgatcaaca tcacttggaa aggaaaggtg   480
 481 gacgaacgcc atgtaggtat cggcgtacgc caagccgggg atgacggatc ggcggccttc   540
 541 cgcatcccgg gattagtgac gacgaataac ggaacattac tcggagtcta cgatattcgc   600
 601 tataatagca gcgtggacct gcaagagaaa atcgatatcg gagtaagccg cagtaccgat   660
 661 aagggacaaa cttgggaacc gatgcgagta gccatgactt tcaaacaaac ggatggcctg   720
 721 ccccacggac aaaacggcgt gggagaccca tcgatcttgg tagacgaaaa gaccaatacg   780
 781 atctgggtag tagccgcatg gacgcatggt atgggtaacg aacgggcttg gtggaactcc   840
 841 atgccgggaa tgacaccgga cgagaccgcc caacttatgc tcgtgaaaag tgaggacgat   900
 901 ggtaagacgt ggagcgaacc gatcaacatc acgtctcaag taaaagaccc gtcttggtat   960
 961 ttcttattgc aaggcccggg acgaggcatc acgatgcaag acggtacttt ggtcttcccc  1020
1021 atccagttta tcgacgctac ccgtgtgccg aacgccggta tcatgtatag caaagaccga  1080
1081 gggaaaacat ggcatctaca caacttggcc cgcacgaata ccaccgaggc gcaagttgcc  1140
1141 gaggtagaac cgggcgtatt gatgctaaat atgcgcgata accgaggcgg tagccgtgcc  1200
1201 gtagccacta caaaggattt aggcaagaca tggacggagc atccttccag ccgtagcgcc  1260
1261 ttacaggaat ccgtttgtat ggccagcttg atcaaggtaa acgccaagga taacatcacc  1320
1321 ggcaaggacc ttctactctt ctccaacccg aacacgacga aagggcgtaa tcatatcacg  1380
1381 atcaaggcga gtctggacgg tggacttact tggcccacgg agcatcaagt cttattagac  1440
1441 gaggccgagg ggtggggata ttcctgtctt tcgatgatcg ataaggaaac ggtaggaatc  1500
1501 ttctacgagt caagcgtagc gcatatgacc ttccaagctg tcaaattaca ggatctcatt  1560
1561 catcaa  1566

Residues: 522 aa
Molecule Weight: 57920.75 Dalton
Number of Met residues: 17
Percentage of Met residues: 3.26 %
Number of Cys residues: 2
Percentage of Cys residues: 0.38 %

>SP16569N|1:541 tid:412664 alias: stage:proposed target Full|1:541 CP Pir/Fasta MKKTFLYFCLLFIVQTAFAADSIYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEITIQ IGDNVDLSDIQAIRLFYSGVEAPSRKGEHFSPVTYISSHIPGNTRKALESYSVRQDEVTA PLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINNKPINITWKGKVD ERHVGIGVRQAGDDGSAAFRIPGLVTTNNGTLLGVYDIRYNSSVDLQEKIDIGVSRSTDK GQTWEPMRVAMTFKQTDGLPHGQNGVGDPSILVDEKTNTIWVVAAWTHGMGNERAWWNSM PGMTPDETAQLMLVKSEDDGKTWSEPINITSQVKDPSWYFLLQGPGRGITMQDGTLVFPI QFIDATRVPNAGIMYSKDRGKTWHLHNLARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAV ATTKDLGKTWTEHPSSRSALQESVCMASLIKVNAKDNITGKDLLLFSNPNTTKGRNHITI KASLDGGLTWPTEHQVLLDEAEGWGYSCLSMIDKETVGIFYESSVAHMTFQAVKLQDLIH Q CDS cDNA 1623 bp 1 atgaaaaaaa ctttcctgta tttctgcctt cttttcatcg tacaaacggc ttttgcggca 60 61 gacagtattt atgtgcgaga gcaacaaatc cccatcttga tagaccggat cgacaatgta 120 121 ctttacgaga tgcggatacc ggcccaaaaa ggggatgtat taaacgagat cacgatacag 180 181 atcggagaca atgtcgacct gtcggacatc caagcgatac gtctatttta tagcggagtg 240 241 gaagctcctt cccgcaaagg ggaacatttc agtcccgtta cgtacatatc cagccatata 300 301 ccgggaaata cccgtaaggc tcttgaatct tattccgtac ggcaagatga ggttaccgcc 360 361 cccttgtcgc gcacggtaaa actaacctct aagcaaccga tgcttaaagg catcaactat 420 421 ttctgggtaa gtatccagat gaagcctgag acttccttat tggcaaaagt agcgaccacg 480 481 atgcctaacg cccagatcaa caacaaaccg atcaacatca cttggaaagg aaaggtggac 540 541 gaacgccatg taggtatcgg cgtacgccaa gccggggatg acggatcggc ggccttccgc 600 601 atcccgggat tagtgacgac gaataacgga acattactcg gagtctacga tattcgctat 660 661 aatagcagcg tggacctgca agagaaaatc gatatcggag taagccgcag taccgataag 720 721 ggacaaactt gggaaccgat gcgagtagcc atgactttca aacaaacgga tggcctgccc 780 781 cacggacaaa acggcgtggg agacccatcg atcttggtag acgaaaagac caatacgatc 840 841 tgggtagtag ccgcatggac gcatggtatg ggtaacgaac gggcttggtg gaactccatg 900 901 ccgggaatga caccggacga gaccgcccaa cttatgctcg tgaaaagtga ggacgatggt 960 961 aagacgtgga gcgaaccgat caacatcacg tctcaagtaa aagacccgtc ttggtatttc 1020 1021 ttattgcaag gcccgggacg aggcatcacg atgcaagacg gtactttggt cttccccatc 1080 1081 cagtttatcg acgctacccg tgtgccgaac gccggtatca tgtatagcaa agaccgaggg 1140 1141 aaaacatggc atctacacaa cttggcccgc acgaatacca ccgaggcgca agttgccgag 1200 1201 gtagaaccgg gcgtattgat gctaaatatg cgcgataacc gaggcggtag ccgtgccgta 1260 1261 gccactacaa aggatttagg caagacatgg acggagcatc cttccagccg tagcgcctta 1320 1321 caggaatccg tttgtatggc cagcttgatc aaggtaaacg ccaaggataa catcaccggc 1380 1381 aaggaccttc tactcttctc caacccgaac acgacgaaag ggcgtaatca tatcacgatc 1440 1441 aaggcgagtc tggacggtgg acttacttgg cccacggagc atcaagtctt attagacgag 1500 1501 gccgaggggt ggggatattc ctgtctttcg atgatcgata aggaaacggt aggaatcttc 1560 1561 tacgagtcaa gcgtagcgca tatgaccttc caagctgtca aattacagga tctcattcat 1620 1621 caa 1623 Residues: 541 aa Molecule Weight: 60187.46 Dalton Number of Met residues: 18 Percentage of Met residues: 3.33 % Number of Cys residues: 3 Percentage of Cys residues: 0.55 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu