LOADING...
   YP_001299918.1;GS13848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299918.1    Target Constructs

Accession: YP_001299918.1
Local acc: GS13848A
Description: gi|150005174|ref|YP_001299918.1| hypothetical protein BVU_2644 [Bacteroides vulgatus ATCC 8482]
Organism: Bacteroides vulgatus ATCC 8482
Residues: 489 aa
Constructs: 3
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>GS13848A|25:489 tid:385740 alias: stage:pdb deposition(pdb id:4QFU) fragment|25:489 CP Pir/Fasta
AKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETGWLMPQRLNRDEVSYYLNKCKDAGY
NMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGIYGYWDHMDYIIKSAASRGIYIGMV
CIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIWMIGGDIRGDNKTEVWDALANSIRS
IDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGHRRYGQRNGDGDYPIEENTEEDNWR
FVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRWNQHDVRRYAYWSVFAGSFGHSYGH
NDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQMKYLKNLMLTFPFFERVPDQSVIAG
TNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKISGAKKNAWWYSAKDGKLEYIGEFDS
KVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTALPDAIQKWNK
CDS  cDNA 1395 bp
   1 gcgaaaacgt atattccctg gaagaacggc aaactggtgg tgtccgagga gggacgctac    60
  61 ctgaagcatg aaaatggagt acctttcttc tggttgggtg aaaccggatg gctgatgccg   120
 121 caacgtttga atcgtgacga ggtttcttac tatctgaata agtgcaagga tgccggatat   180
 181 aacatggtgc aggtgcaggt attgaacggt gtgccttcca tgaatattta cggccagtat   240
 241 tccatgacag acggttttaa tttcaaagat atcaaccgca aagggattta tggatattgg   300
 301 gaccacatgg actatattat taaaagtgcc gcttcacggg gtatctatat agggatggta   360
 361 tgtatttggg gaactcccgt ggaacaaggg ctgatgaatg aaaaagaagc cgtggcatac   420
 421 ggtaagtttc ttgcagaacg ttacaaggat gagccgaata ttatttggat gataggaggg   480
 481 gatatccgcg gtgataataa gacggaggta tgggatgcgt tggcaaacag tatccgcagc   540
 541 atagacaaag gtcatctgat gactttccat ccgcgtggac gtactacgtc ggctacttgg   600
 601 tttaatgacc gcgaatggct ggatttcaat atgttccaaa gcggacaccg tcgttacggg   660
 661 cagcgtaacg gtgatggtga ctatcctatc gaagagaata cggaagagga taactggcgt   720
 721 tttgtggaag ccagtcaggc aaagactccg ttgaaaccgg tgattgatga cgaacctatt   780
 781 tatgaagaca ttccacaggg gctgcatgat cccaatgaaa cccgttggaa tcagcacgat   840
 841 gtgcgtcgtt atgcctattg gtcggtattt gccggatcat tcgggcactc atacggtcat   900
 901 aatgatatca tgcaatttat ccgtcccgga tatggagcct ctttcggcgc cgacggacgt   960
 961 aagaaagcat ggtgggatgc tttggaagac cccggtttca atcagatgaa atatctgaag  1020
1021 aacttgatgc tgacttttcc tttctttgaa cgtgtacccg atcagagtgt cattgcagga  1080
1081 actaacggcg aacgctatga ccgtgccatc gctacccgtg gaaatgacta tttgctggtt  1140
1141 tacaattact caggacgtcc tatgcagatc gatttgagca aaatcagcgg tgcgaaaaag  1200
1201 aatgcatggt ggtatagcgc gaaggacggt aagttggaat atatcggtga gtttgacagt  1260
1261 aaagtcactt ctttccagca tgatagcggt tatctgagcg gcaatgatca ggttctgatt  1320
1321 gttgtggatt ctgcgaagga ttatgtgcag aaagcttgga cagccttgcc ggatgccata  1380
1381 cagaaatgga ataag  1395

Residues: 465 aa
Molecule Weight: 53754.64 Dalton
Number of Met residues: 14
Percentage of Met residues: 3.01 %
Number of Cys residues: 2
Percentage of Cys residues: 0.43 %

>GS13848A|1:489 tid:384453 alias: stage:proposed target Full|1:489 CP Pir/Fasta MNRHALLSLLALLLCCSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETG WLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGI YGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIW MIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGH RRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRW NQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQM KYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKIS GAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTAL PDAIQKWNK CDS cDNA 1467 bp 1 atgaacagac acgcattact ttccttattg gctttattgc tatgttgctc tacttcgttg 60 61 ccggcgcaga aagcgaaaac gtatattccc tggaagaacg gcaaactggt ggtgtccgag 120 121 gagggacgct acctgaagca tgaaaatgga gtacctttct tctggttggg tgaaaccgga 180 181 tggctgatgc cgcaacgttt gaatcgtgac gaggtttctt actatctgaa taagtgcaag 240 241 gatgccggat ataacatggt gcaggtgcag gtattgaacg gtgtgccttc catgaatatt 300 301 tacggccagt attccatgac agacggtttt aatttcaaag atatcaaccg caaagggatt 360 361 tatggatatt gggaccacat ggactatatt attaaaagtg ccgcttcacg gggtatctat 420 421 atagggatgg tatgtatttg gggaactccc gtggaacaag ggctgatgaa tgaaaaagaa 480 481 gccgtggcat acggtaagtt tcttgcagaa cgttacaagg atgagccgaa tattatttgg 540 541 atgataggag gggatatccg cggtgataat aagacggagg tatgggatgc gttggcaaac 600 601 agtatccgca gcatagacaa aggtcatctg atgactttcc atccgcgtgg acgtactacg 660 661 tcggctactt ggtttaatga ccgcgaatgg ctggatttca atatgttcca aagcggacac 720 721 cgtcgttacg ggcagcgtaa cggtgatggt gactatccta tcgaagagaa tacggaagag 780 781 gataactggc gttttgtgga agccagtcag gcaaagactc cgttgaaacc ggtgattgat 840 841 gacgaaccta tttatgaaga cattccacag gggctgcatg atcccaatga aacccgttgg 900 901 aatcagcacg atgtgcgtcg ttatgcctat tggtcggtat ttgccggatc attcgggcac 960 961 tcatacggtc ataatgatat catgcaattt atccgtcccg gatatggagc ctctttcggc 1020 1021 gccgacggac gtaagaaagc atggtgggat gctttggaag accccggttt caatcagatg 1080 1081 aaatatctga agaacttgat gctgactttt cctttctttg aacgtgtacc cgatcagagt 1140 1141 gtcattgcag gaactaacgg cgaacgctat gaccgtgcca tcgctacccg tggaaatgac 1200 1201 tatttgctgg tttacaatta ctcaggacgt cctatgcaga tcgatttgag caaaatcagc 1260 1261 ggtgcgaaaa agaatgcatg gtggtatagc gcgaaggacg gtaagttgga atatatcggt 1320 1321 gagtttgaca gtaaagtcac ttctttccag catgatagcg gttatctgag cggcaatgat 1380 1381 caggttctga ttgttgtgga ttctgcgaag gattatgtgc agaaagcttg gacagccttg 1440 1441 ccggatgcca tacagaaatg gaataag 1467 Residues: 489 aa Molecule Weight: 56333.64 Dalton Number of Met residues: 15 Percentage of Met residues: 3.07 % Number of Cys residues: 4 Percentage of Cys residues: 0.82 %

>GS13848A|1:489 tid:409762 alias: stage:proposed target Full|1:489 CP Pir/Fasta MNRHALLSLLALLLCCSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETG WLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGI YGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIW MIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGH RRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRW NQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQM KYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKIS GAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTAL PDAIQKWNK CDS cDNA 1467 bp 1 atgaacagac acgcattact ttccttattg gctttattgc tatgttgctc tacttcgttg 60 61 ccggcgcaga aagcgaaaac gtatattccc tggaagaacg gcaaactggt ggtgtccgag 120 121 gagggacgct acctgaagca tgaaaatgga gtacctttct tctggttggg tgaaaccgga 180 181 tggctgatgc cgcaacgttt gaatcgtgac gaggtttctt actatctgaa taagtgcaag 240 241 gatgccggat ataacatggt gcaggtgcag gtattgaacg gtgtgccttc catgaatatt 300 301 tacggccagt attccatgac agacggtttt aatttcaaag atatcaaccg caaagggatt 360 361 tatggatatt gggaccacat ggactatatt attaaaagtg ccgcttcacg gggtatctat 420 421 atagggatgg tatgtatttg gggaactccc gtggaacaag ggctgatgaa tgaaaaagaa 480 481 gccgtggcat acggtaagtt tcttgcagaa cgttacaagg atgagccgaa tattatttgg 540 541 atgataggag gggatatccg cggtgataat aagacggagg tatgggatgc gttggcaaac 600 601 agtatccgca gcatagacaa aggtcatctg atgactttcc atccgcgtgg acgtactacg 660 661 tcggctactt ggtttaatga ccgcgaatgg ctggatttca atatgttcca aagcggacac 720 721 cgtcgttacg ggcagcgtaa cggtgatggt gactatccta tcgaagagaa tacggaagag 780 781 gataactggc gttttgtgga agccagtcag gcaaagactc cgttgaaacc ggtgattgat 840 841 gacgaaccta tttatgaaga cattccacag gggctgcatg atcccaatga aacccgttgg 900 901 aatcagcacg atgtgcgtcg ttatgcctat tggtcggtat ttgccggatc attcgggcac 960 961 tcatacggtc ataatgatat catgcaattt atccgtcccg gatatggagc ctctttcggc 1020 1021 gccgacggac gtaagaaagc atggtgggat gctttggaag accccggttt caatcagatg 1080 1081 aaatatctga agaacttgat gctgactttt cctttctttg aacgtgtacc cgatcagagt 1140 1141 gtcattgcag gaactaacgg cgaacgctat gaccgtgcca tcgctacccg tggaaatgac 1200 1201 tatttgctgg tttacaatta ctcaggacgt cctatgcaga tcgatttgag caaaatcagc 1260 1261 ggtgcgaaaa agaatgcatg gtggtatagc gcgaaggacg gtaagttgga atatatcggt 1320 1321 gagtttgaca gtaaagtcac ttctttccag catgatagcg gttatctgag cggcaatgat 1380 1381 caggttctga ttgttgtgga ttctgcgaag gattatgtgc agaaagcttg gacagccttg 1440 1441 ccggatgcca tacagaaatg gaataag 1467 Residues: 489 aa Molecule Weight: 56333.64 Dalton Number of Met residues: 15 Percentage of Met residues: 3.07 % Number of Cys residues: 4 Percentage of Cys residues: 0.82 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu