LOADING...
   YP_001297591.1;GS13522A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297591.1    Target Constructs

Accession: YP_001297591.1
Local acc: GS13522A
Description: gi|150002847|ref|YP_001297591.1| hypothetical protein BVU_0247 [Bacteroides vulgatus ATCC 8482]
Organism: Bacteroides vulgatus ATCC 8482
Residues: 382 aa
Constructs: 4
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>GS13522A|30:382 tid:393205 alias: stage:pdb deposition(pdb id:3S30) fragment|30:382 CP Pir/Fasta
ADILNCILPAEMLTGTDIDYNRPYDKSLNAYPIYIEVNNGTDLTRLAPTFELTEGASIEP
ANGSTQNFTNPVRYTVTSEDKNWHRTYAINIHYPETKSIPTVFNFENVKTVPYNKNEYYV
LYEAASGYSTLTWSSGNQGFALTGSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLV
GMPIAAGNLFIGSFDIGSAMSDALSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGESTN
RKDVFNIYALFYEKTKDVQMLDGHIAKNNYEHENMVAAAVITDTHETSEWTRFELDFNYE
HYGKTIDPQKLANGGYNVSIVLSASKDGDVFQGAPGSTLLIDDLELVCKQPLR
CDS  cDNA 1059 bp
   1 gcggacatct tgaactgcat cctccctgcc gagatgctga caggtacaga cattgactat    60
  61 aaccgtcctt acgacaaaag cctgaacgct taccctattt acatagaagt aaacaacggt   120
 121 accgacctga cccgactagc tcccactttc gagctgactg aaggagcatc tatcgaaccg   180
 181 gccaacggaa gtacacagaa tttcaccaac ccagtgcgct ataccgtaac atccgaggac   240
 241 aagaattggc accgcaccta cgccatcaat atccattatc cagaaaccaa aagcatcccg   300
 301 acggttttta actttgaaaa cgtaaaaacc gtaccttaca ataaaaatga atattatgtg   360
 361 ctatacgaag cagcctctgg ctactccaca ctaacatggt ccagtggtaa tcagggattt   420
 421 gccttaaccg gaagcggtta cactccgaac gacttcccta ccagcatcag tccaaacggc   480
 481 cgcacaggca actgcttgca actgattact cgcaaaacag gaagtttagg cactttggta   540
 541 ggtatgccca ttgcagcagg taacctgttc attggcagtt tcgacatagg ctccgccatg   600
 601 agcgatgcgt tgtcggcaac caaattcgga acaaccttct attatgaacc cattaaattg   660
 661 gtcggctact acaaatacaa agcaggacca gaattctatg agaacggaga atctaccaac   720
 721 cgaaaagacg ttttcaatat ctatgccttg ttttacgaaa agaccaaaga cgtgcagatg   780
 781 ctggatggcc atatcgcaaa gaacaattat gaacatgaaa acatggtagc cgctgctgtc   840
 841 ataaccgaca cgcatgaaac aagcgaatgg acccgctttg aactggactt caactatgag   900
 901 cattatggaa aaacaataga tccccaaaaa ttggcaaacg gaggatacaa cgtcagcatt   960
 961 gtcctatcgg caagcaagga cggtgatgta tttcaaggcg caccgggtag caccctgctt  1020
1021 attgacgacc tggaactggt atgcaaacaa ccacttaga  1059

Residues: 353 aa
Molecule Weight: 39237.61 Dalton
Number of Met residues: 5
Percentage of Met residues: 1.42 %
Number of Cys residues: 3
Percentage of Cys residues: 0.85 %

>GS13522A|31:382 tid:385581 alias: stage:protein purification fragment|31:382 CP Pir/Fasta DILNCILPAEMLTGTDIDYNRPYDKSLNAYPIYIEVNNGTDLTRLAPTFELTEGASIEPA NGSTQNFTNPVRYTVTSEDKNWHRTYAINIHYPETKSIPTVFNFENVKTVPYNKNEYYVL YEAASGYSTLTWSSGNQGFALTGSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLVG MPIAAGNLFIGSFDIGSAMSDALSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGESTNR KDVFNIYALFYEKTKDVQMLDGHIAKNNYEHENMVAAAVITDTHETSEWTRFELDFNYEH YGKTIDPQKLANGGYNVSIVLSASKDGDVFQGAPGSTLLIDDLELVCKQPLR CDS cDNA 1056 bp 1 gacatcttga actgcatcct ccctgccgag atgctgacag gtacagacat tgactataac 60 61 cgtccttacg acaaaagcct gaacgcttac cctatttaca tagaagtaaa caacggtacc 120 121 gacctgaccc gactagctcc cactttcgag ctgactgaag gagcatctat cgaaccggcc 180 181 aacggaagta cacagaattt caccaaccca gtgcgctata ccgtaacatc cgaggacaag 240 241 aattggcacc gcacctacgc catcaatatc cattatccag aaaccaaaag catcccgacg 300 301 gtttttaact ttgaaaacgt aaaaaccgta ccttacaata aaaatgaata ttatgtgcta 360 361 tacgaagcag cctctggcta ctccacacta acatggtcca gtggtaatca gggatttgcc 420 421 ttaaccggaa gcggttacac tccgaacgac ttccctacca gcatcagtcc aaacggccgc 480 481 acaggcaact gcttgcaact gattactcgc aaaacaggaa gtttaggcac tttggtaggt 540 541 atgcccattg cagcaggtaa cctgttcatt ggcagtttcg acataggctc cgccatgagc 600 601 gatgcgttgt cggcaaccaa attcggaaca accttctatt atgaacccat taaattggtc 660 661 ggctactaca aatacaaagc aggaccagaa ttctatgaga acggagaatc taccaaccga 720 721 aaagacgttt tcaatatcta tgccttgttt tacgaaaaga ccaaagacgt gcagatgctg 780 781 gatggccata tcgcaaagaa caattatgaa catgaaaaca tggtagccgc tgctgtcata 840 841 accgacacgc atgaaacaag cgaatggacc cgctttgaac tggacttcaa ctatgagcat 900 901 tatggaaaaa caatagatcc ccaaaaattg gcaaacggag gatacaacgt cagcattgtc 960 961 ctatcggcaa gcaaggacgg tgatgtattt caaggcgcac cgggtagcac cctgcttatt 1020 1021 gacgacctgg aactggtatg caaacaacca cttaga 1056 Residues: 352 aa Molecule Weight: 39166.54 Dalton Number of Met residues: 5 Percentage of Met residues: 1.42 % Number of Cys residues: 3 Percentage of Cys residues: 0.85 %

>GS13522A|1:382 tid:384365 alias: stage:proposed target Full|1:382 CP Pir/Fasta MKLKNLFTCTVTGLLLCTSCIKDEAPNAEADILNCILPAEMLTGTDIDYNRPYDKSLNAY PIYIEVNNGTDLTRLAPTFELTEGASIEPANGSTQNFTNPVRYTVTSEDKNWHRTYAINI HYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQGFALTGSGYTPND FPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDALSATKFGT TFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQMLDGHIAKNNYE HENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVSIVLSASKDGDVF QGAPGSTLLIDDLELVCKQPLR CDS cDNA 1146 bp 1 atgaagctga aaaacttatt cacctgcaca gtaacaggat tgctcctttg cacctcctgt 60 61 atcaaggacg aagcccccaa tgcggaagcg gacatcttga actgcatcct ccctgccgag 120 121 atgctgacag gtacagacat tgactataac cgtccttacg acaaaagcct gaacgcttac 180 181 cctatttaca tagaagtaaa caacggtacc gacctgaccc gactagctcc cactttcgag 240 241 ctgactgaag gagcatctat cgaaccggcc aacggaagta cacagaattt caccaaccca 300 301 gtgcgctata ccgtaacatc cgaggacaag aattggcacc gcacctacgc catcaatatc 360 361 cattatccag aaaccaaaag catcccgacg gtttttaact ttgaaaacgt aaaaaccgta 420 421 ccttacaata aaaatgaata ttatgtgcta tacgaagcag cctctggcta ctccacacta 480 481 acatggtcca gtggtaatca gggatttgcc ttaaccggaa gcggttacac tccgaacgac 540 541 ttccctacca gcatcagtcc aaacggccgc acaggcaact gcttgcaact gattactcgc 600 601 aaaacaggaa gtttaggcac tttggtaggt atgcccattg cagcaggtaa cctgttcatt 660 661 ggcagtttcg acataggctc cgccatgagc gatgcgttgt cggcaaccaa attcggaaca 720 721 accttctatt atgaacccat taaattggtc ggctactaca aatacaaagc aggaccagaa 780 781 ttctatgaga acggagaatc taccaaccga aaagacgttt tcaatatcta tgccttgttt 840 841 tacgaaaaga ccaaagacgt gcagatgctg gatggccata tcgcaaagaa caattatgaa 900 901 catgaaaaca tggtagccgc tgctgtcata accgacacgc atgaaacaag cgaatggacc 960 961 cgctttgaac tggacttcaa ctatgagcat tatggaaaaa caatagatcc ccaaaaattg 1020 1021 gcaaacggag gatacaacgt cagcattgtc ctatcggcaa gcaaggacgg tgatgtattt 1080 1081 caaggcgcac cgggtagcac cctgcttatt gacgacctgg aactggtatg caaacaacca 1140 1141 cttaga 1146 Residues: 382 aa Molecule Weight: 42377.17 Dalton Number of Met residues: 6 Percentage of Met residues: 1.57 % Number of Cys residues: 6 Percentage of Cys residues: 1.57 %

>GS13522A|1:382 tid:409747 alias: stage:proposed target Full|1:382 CP Pir/Fasta MKLKNLFTCTVTGLLLCTSCIKDEAPNAEADILNCILPAEMLTGTDIDYNRPYDKSLNAY PIYIEVNNGTDLTRLAPTFELTEGASIEPANGSTQNFTNPVRYTVTSEDKNWHRTYAINI HYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQGFALTGSGYTPND FPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDALSATKFGT TFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQMLDGHIAKNNYE HENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVSIVLSASKDGDVF QGAPGSTLLIDDLELVCKQPLR CDS cDNA 1146 bp 1 atgaagctga aaaacttatt cacctgcaca gtaacaggat tgctcctttg cacctcctgt 60 61 atcaaggacg aagcccccaa tgcggaagcg gacatcttga actgcatcct ccctgccgag 120 121 atgctgacag gtacagacat tgactataac cgtccttacg acaaaagcct gaacgcttac 180 181 cctatttaca tagaagtaaa caacggtacc gacctgaccc gactagctcc cactttcgag 240 241 ctgactgaag gagcatctat cgaaccggcc aacggaagta cacagaattt caccaaccca 300 301 gtgcgctata ccgtaacatc cgaggacaag aattggcacc gcacctacgc catcaatatc 360 361 cattatccag aaaccaaaag catcccgacg gtttttaact ttgaaaacgt aaaaaccgta 420 421 ccttacaata aaaatgaata ttatgtgcta tacgaagcag cctctggcta ctccacacta 480 481 acatggtcca gtggtaatca gggatttgcc ttaaccggaa gcggttacac tccgaacgac 540 541 ttccctacca gcatcagtcc aaacggccgc acaggcaact gcttgcaact gattactcgc 600 601 aaaacaggaa gtttaggcac tttggtaggt atgcccattg cagcaggtaa cctgttcatt 660 661 ggcagtttcg acataggctc cgccatgagc gatgcgttgt cggcaaccaa attcggaaca 720 721 accttctatt atgaacccat taaattggtc ggctactaca aatacaaagc aggaccagaa 780 781 ttctatgaga acggagaatc taccaaccga aaagacgttt tcaatatcta tgccttgttt 840 841 tacgaaaaga ccaaagacgt gcagatgctg gatggccata tcgcaaagaa caattatgaa 900 901 catgaaaaca tggtagccgc tgctgtcata accgacacgc atgaaacaag cgaatggacc 960 961 cgctttgaac tggacttcaa ctatgagcat tatggaaaaa caatagatcc ccaaaaattg 1020 1021 gcaaacggag gatacaacgt cagcattgtc ctatcggcaa gcaaggacgg tgatgtattt 1080 1081 caaggcgcac cgggtagcac cctgcttatt gacgacctgg aactggtatg caaacaacca 1140 1141 cttaga 1146 Residues: 382 aa Molecule Weight: 42377.17 Dalton Number of Met residues: 6 Percentage of Met residues: 1.57 % Number of Cys residues: 6 Percentage of Cys residues: 1.57 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu