LOADING...
   YP_001087438.1;SP19352A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001087438.1    Target Constructs

Accession: YP_001087438.1
Local acc: SP19352A
Description: gi|126698541|ref|YP_001087438.1| putative phage lipoprotein [Clostridium difficile 630]
Organism: CLOSTRIDIUM DIFFICILE 630
Residues: 186 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP19352A|26:186 tid:418108 alias: stage:pdb deposition(pdb id:5BXG) fragment|26:186 CP Pir/Fasta
ESPEESSKNNEPKKEEKKDKEVVIGEKIISDKMEITINNIEFSYDVLPKVKESLYTHYPA
ESGKVYIDIAADIKNTQKQELNCSDLLTIEANYNDGYKYSSQTIVEDETTGFTYDNISSI
DPLETKGVRFIIDCPDEVKTSDKPVILSFTFDGNKYVYKMK
CDS  cDNA 483 bp
   1 gaaagtccag aggagagtag taaaaataat gaaccaaaaa aagaagaaaa aaaggataaa    60
  61 gaagtagtca taggagagaa aattatttca gataaaatgg aaatcactat taataatatt   120
 121 gaattctctt atgatgtttt accaaaggtt aaggaaagtt tatatacaca ttatcctgct   180
 181 gagtcaggca aagtatatat tgatattgct gctgatataa aaaatactca aaaacaagag   240
 241 ttaaattgtt cagatttact aactattgaa gcaaattata atgatgggta taaatattca   300
 301 tcacaaacaa tagtagaaga tgaaaccaca ggttttactt atgataatat ttctagtatt   360
 361 gaccctttag aaacaaaggg agttagattt ataatcgatt gccctgatga agtaaaaaca   420
 421 agtgataagc cagtaatatt aagttttaca tttgatggga ataagtatgt ttataaaatg   480
 481 aag   483

Residues: 161 aa
Molecule Weight: 18402.60 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.24 %
Number of Cys residues: 2
Percentage of Cys residues: 1.24 %

>SP19352A|1:186 tid:410058 alias: stage:proposed target Full|1:186 CP Pir/Fasta MKKKVCFLFSILIVICLAIVGCSNSESPEESSKNNEPKKEEKKDKEVVIGEKIISDKMEI TINNIEFSYDVLPKVKESLYTHYPAESGKVYIDIAADIKNTQKQELNCSDLLTIEANYND GYKYSSQTIVEDETTGFTYDNISSIDPLETKGVRFIIDCPDEVKTSDKPVILSFTFDGNK YVYKMK CDS cDNA 558 bp 1 atgaagaaaa aagtatgttt tttattttct attcttatag ttatctgttt agctattgta 60 61 ggatgttcta attcagaaag tccagaggag agtagtaaaa ataatgaacc aaaaaaagaa 120 121 gaaaaaaagg ataaagaagt agtcatagga gagaaaatta tttcagataa aatggaaatc 180 181 actattaata atattgaatt ctcttatgat gttttaccaa aggttaagga aagtttatat 240 241 acacattatc ctgctgagtc aggcaaagta tatattgata ttgctgctga tataaaaaat 300 301 actcaaaaac aagagttaaa ttgttcagat ttactaacta ttgaagcaaa ttataatgat 360 361 gggtataaat attcatcaca aacaatagta gaagatgaaa ccacaggttt tacttatgat 420 421 aatatttcta gtattgaccc tttagaaaca aagggagtta gatttataat cgattgccct 480 481 gatgaagtaa aaacaagtga taagccagta atattaagtt ttacatttga tgggaataag 540 541 tatgtttata aaatgaag 558 Residues: 186 aa Molecule Weight: 21114.90 Dalton Number of Met residues: 3 Percentage of Met residues: 1.61 % Number of Cys residues: 5 Percentage of Cys residues: 2.69 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu