LOADING...
   TM1526;TM1526
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1526    Target Constructs

Accession: TM1526
Local acc: TM1526
Description: TM1526 hypothetical protein
Organism: THERMOTOGA MARITIMA
Residues: 145 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM1526|1:145 tid:283383 alias: stage:pdb deposition(pdb id:1VJX) Full|1:145 CP Pir/Fasta
MKVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKMSDQENWD
EVDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNSDAQ
KTVKKIIDQEKEHLRKLLEMKREST
CDS  cDNA 435 bp
   1 atgaaagtaa gcgacattct gacagtggcc atcaggctgg aagaggaagg cgaaagattc    60
  61 tacagggaac tatcagaaca ttttaatgga gagataaaga agactttcct tgagcttgcc   120
 121 gatcaggaaa ggattcatgc ggaaatcttt agaaagatgt cagaccagga aaactgggat   180
 181 gaggtggatt cttatctcgc gggatacgct ttctatgaag tttttcctga cacgagtgaa   240
 241 attttaagga gaaaggatct aaccttgaaa gaggttctgg atatagccat atccgttgaa   300
 301 aaagacagca taattctcta ctatgaactc aaagatggtc ttgtgaattc cgatgcacag   360
 361 aaaacagtga aaaagatcat cgatcaggaa aaagaacatc taagaaagct tctcgagatg   420
 421 aaacgtgaaa gtacc   435

Residues: 145 aa
Molecule Weight: 17192.62 Dalton
Number of Met residues: 3
Percentage of Met residues: 2.07 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu