LOADING...
   TM1394;TM1394
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1394    Target Constructs

Accession: TM1394
Local acc: TM1394
Description: TM1394 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
Residues: 290 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM1394|1:290 tid:283255 alias: stage:pdb deposition(pdb id:1VQ0) Full|1:290 CP Pir/Fasta
MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW
TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLG
LKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTL
EQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIKYKCDCNREKAKN
ALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDSGS
CDS  cDNA 870 bp
   1 atgatttact atggcacgat gttcgatcac aaggtgagat tttcgatcgt tcgaatgaga    60
  61 gaagtggtgg aagaggctcg aaacaggcac gccctttcat acctcgccac ggtggtactc   120
 121 ggaagagccc tcatcggtgc ggctcttgta acaccatggc tcgccgaaaa agaaaggtgg   180
 181 acgctggaca tagagggaaa cgggccaata aggagagtcg ttgcacagtc gaccagcgaa   240
 241 ttcactgtca ggggatatgt ggcaaatccc aaggtggaac tgcccctaaa tgaaaaggga   300
 301 aagttcgatg tcgccggtgc tatcggtcag ggtgttctca gagtggtaag agatctggga   360
 361 ttgaaaactc cctttgtctc tcaggtgcct ctggtgagcg gtgagatcgc cgaagacctg   420
 421 gcttattatt tcgcggtttc tgaacagata ccatccgctt tttccatcgg tgttcttgtg   480
 481 gactcagacg gtgtgaagat cgcgggagga ttcgccgtcc aaatcatcga tcgcactctt   540
 541 gaacaggaga aggtggagat gatagagaaa aacatcaaaa accttcccag tatatcaaaa   600
 601 cttttccagg aagcagaacc tctggacgtt ctggaaagaa tattcggtga gaaggtaggg   660
 661 ttcgtcgaaa cagcggaaat aaagtacaaa tgcgattgca acagggaaaa agccaaaaac   720
 721 gcccttctag tcctggacaa aaaagaattg gaagatatgc gaaaagaagg gaagggagaa   780
 781 gtcgtctgta agtggtgtaa cacaagatac gttttctcag aggaggaatt agaagaactc   840
 841 ctcaagttca aggtagatga ctctggttcc   870

Residues: 290 aa
Molecule Weight: 32538.84 Dalton
Number of Met residues: 5
Percentage of Met residues: 1.72 %
Number of Cys residues: 4
Percentage of Cys residues: 1.38 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu