LOADING...
   TM1158;TM1158
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1158    Target Constructs

Accession: TM1158
Local acc: TM1158
Description: TM1158 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
Residues: 227 aa
Constructs: 1
Warning: the change of start codon from ATG/M to GTG/V(see CP);
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM1158|1:227 tid:283024 alias: stage:pdb deposition(pdb id:1O1Y) Full|1:227 CP Pir/Fasta
VRVLAIRHVEIEDLGMMEDIFREKNWSFDYLDTPKGEKLERPLEEYSLVVLLGGYMGAYE
EEKYPFLKYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNGEEIGWYFVEKVS
DNKFFREFPDRLRVFQWHGDTFDLPRRATRVFTSEKYENQGFVYGKAVGLQFHIEVGART
MKRWIEAYKDELEKKKIDPRLLLETAEREEKVLKGLLRSLLERMVES
CDS  cDNA 681 bp
   1 gtgagagtgc tcgctattag acacgtcgag atagaggacc ttggaatgat ggaagatatc    60
  61 ttcagggaga agaactggag tttcgattat ctggacactc caaaagggga aaaactcgaa   120
 121 aggcctctcg aagagtattc tctcgtggtg cttcttggag ggtatatggg agcctacgag   180
 181 gaagagaaat accctttttt gaagtacgaa tttcagttga tagaagagat cctgaaaaaa   240
 241 gaaatcccgt tccttggaat atgtctgggt tctcagatgc tcgctaaagt ccttggggcg   300
 301 agtgtctaca gaggaaaaaa cggagaagaa ataggctggt attttgttga aaaggtctcc   360
 361 gacaataagt ttttcagaga atttccagac agactgcggg tgtttcagtg gcatggagat   420
 421 actttcgatc ttccacgcag agcaaccagg gtctttactt ctgaaaagta tgaaaaccag   480
 481 ggattcgtct atggcaaggc tgtggggctc cagttccata tagaagtggg agccagaacc   540
 541 atgaaacgct ggatagaggc atacaaagat gaacttgaaa aaaagaagat agatcccagg   600
 601 cttctccttg aaacggcgga gagggaggaa aaagtcctga aaggcctctt gaggtctctt   660
 661 ttggaaagga tggtggaaag c   681

Residues: 227 aa
Molecule Weight: 26898.77 Dalton
Number of Met residues: 7
Percentage of Met residues: 3.08 %
Number of Cys residues: 1
Percentage of Cys residues: 0.44 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu