LOADING...
   TM1040;TM1040
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1040    Target Constructs

Accession: TM1040
Local acc: TM1040
Description: TM1040 histidinol-phosphate aminotransferase (hisC)
Organism: THERMOTOGA MARITIMA
Residues: 335 aa
Constructs: 2
Warning: the change of start codon from ATG/M to GTG/V(see CP);
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM1040|1:335 tid:359801 alias: stage:pdb deposition(pdb id:2F8J) Full|1:335 CP Pir/Fasta
VNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEE
LIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKF
LEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTGAFVALDEAYYEFH
GESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF
AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHL
RTKNVAVRSFREGVRITIGKREENDMILRELEVFK
CDS  cDNA 1005 bp
   1 gtgaatcctc tcgatttgat tgcaaagagg gcgtatccgt acgaaaccga aaagagagac    60
  61 aaaacctacc ttgcgctgaa tgaaaatccg tttccctttc cagaggacct cgtggatgaa   120
 121 gtgtttcgac gattgaacag cgacgccctg aggatctact acgactcccc cgatgaagaa   180
 181 ttaatagaaa agatactctc atacctcgac accgattttc tttcgaaaaa caacgtctct   240
 241 gtgggaaacg gagcggatga gatcatctac gtgatgatgc tcatgttcga ccgttccgtt   300
 301 ttctttcccc cgacctacag ctgctacagg atctttgcga aggcagttgg agcgaaattc   360
 361 ctggaagtgc cgctcacgaa agatctgagg atacctgagg tgaacgtggg agaaggagac   420
 421 gttgttttca ttccgaaccc gaacaatcca acgggccatg tcttcgaaag agaggaaata   480
 481 gaaagaatcc tgaaaacggg tgccttcgtc gcgctggacg aagcctacta cgaattccac   540
 541 ggagaaagtt atgtggattt tctgaagaaa tacgaaaatc tcgctgtgat caggactttc   600
 601 tcgaaagcgt tttccctggc agcgcaacgt gtcggatacg ttgtggcctc ggagaagttc   660
 661 attgacgctt acaacagggt gagacttcct ttcaacgtga gctacgtctc ccagatgttc   720
 721 gcaaaggtag ctctcgatca cagagagatc tttgaagaaa gaacgaagtt catcgtggaa   780
 781 gaacgcgaga ggatgaagag tgctctcagg gaaatgggat accgaatcac cgactccaga   840
 841 ggaaacttcg tgttcgtatt catggagaag gaagaaaaag aaagacttct cgaacacctc   900
 901 cggacgaaga acgtcgctgt tcgcagtttc agggaaggtg ttagaatcac tatcggaaaa   960
 961 cgcgaagaga acgatatgat tctgagagaa ctggaggtgt tcaaa  1005

Residues: 335 aa
Molecule Weight: 39295.93 Dalton
Number of Met residues: 9
Percentage of Met residues: 2.69 %
Number of Cys residues: 1
Percentage of Cys residues: 0.30 %

>TM1040|1:335 tid:282907 alias: stage:proposed target Full|1:335 CP Pir/Fasta VNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEE LIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKF LEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTGAFVALDEAYYEFH GESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHL RTKNVAVRSFREGVRITIGKREENDMILRELEVFK CDS cDNA 1005 bp 1 gtgaatcctc tcgatttgat tgcaaagagg gcgtatccgt acgaaaccga aaagagagac 60 61 aaaacctacc ttgcgctgaa tgaaaatccg tttccctttc cagaggacct cgtggatgaa 120 121 gtgtttcgac gattgaacag cgacgccctg aggatctact acgactcccc cgatgaagaa 180 181 ttaatagaaa agatactctc atacctcgac accgattttc tttcgaaaaa caacgtctct 240 241 gtgggaaacg gagcggatga gatcatctac gtgatgatgc tcatgttcga ccgttccgtt 300 301 ttctttcccc cgacctacag ctgctacagg atctttgcga aggcagttgg agcgaaattc 360 361 ctggaagtgc cgctcacgaa agatctgagg atacctgagg tgaacgtggg agaaggagac 420 421 gttgttttca ttccgaaccc gaacaatcca acgggccatg tcttcgaaag agaggaaata 480 481 gaaagaatcc tgaaaacggg tgccttcgtc gcgctggacg aagcctacta cgaattccac 540 541 ggagaaagtt atgtggattt tctgaagaaa tacgaaaatc tcgctgtgat caggactttc 600 601 tcgaaagcgt tttccctggc agcgcaacgt gtcggatacg ttgtggcctc ggagaagttc 660 661 attgacgctt acaacagggt gagacttcct ttcaacgtga gctacgtctc ccagatgttc 720 721 gcaaaggtag ctctcgatca cagagagatc tttgaagaaa gaacgaagtt catcgtggaa 780 781 gaacgcgaga ggatgaagag tgctctcagg gaaatgggat accgaatcac cgactccaga 840 841 ggaaacttcg tgttcgtatt catggagaag gaagaaaaag aaagacttct cgaacacctc 900 901 cggacgaaga acgtcgctgt tcgcagtttc agggaaggtg ttagaatcac tatcggaaaa 960 961 cgcgaagaga acgatatgat tctgagagaa ctggaggtgt tcaaa 1005 Residues: 335 aa Molecule Weight: 39295.93 Dalton Number of Met residues: 9 Percentage of Met residues: 2.69 % Number of Cys residues: 1 Percentage of Cys residues: 0.30 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu