LOADING...
   TM1009;TM1009
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1009    Target Constructs

Accession: TM1009
Local acc: TM1009
Description: TM1009 oxidoreductase, aldo/keto reductase family
Organism: THERMOTOGA MARITIMA
Residues: 286 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM1009|1:286 tid:282876 alias: stage:pdb deposition(pdb id:1VP5) Full|1:286 CP Pir/Fasta
MQVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAI
KRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHC
AWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRN
YNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERM
KENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLKR
CDS  cDNA 858 bp
   1 atgcaggttc caaaagttac tttgaacaac ggtgtagaaa tgcctattct gggatacgga    60
  61 gttttccaga taccaccaga aaagacggaa gaatgtgtct atgaggctat aaaggtggga   120
 121 tacagactca tcgacacagc agcatcgtac atgaacgaag agggagtggg aagagcgata   180
 181 aaacgcgcga ttgacgaagg aattgtcaga agagaggagc tcttcgtcac gaccaaactg   240
 241 tgggtgtcgg atgttggtta cgaatccaca aagaaggctt ttgaaaagtc tttgaagaaa   300
 301 ctgcaactcg aatacataga tctctatcta attcatcaac cttttggaga tgtacactgt   360
 361 gcctggaaag ctatggaaga aatgtacaaa gatggattgg taagagccat aggtgtgagc   420
 421 aacttctacc ctgatcggtt gatggatcta atggttcatc acgaaattgt tcccgcggtg   480
 481 aaccagatcg agatacatcc gttttatcag agacaagagg agatcgaatt catgagaaat   540
 541 tacaacatcc aacctgaagc ttggggtcct ttcgctgagg gaagaaaaaa cattttccag   600
 601 aacggagtgc tcagatcgat cgcggaaaag tacggcaaaa cggttgcaca ggtcattctg   660
 661 agatggctca ctcagaaagg aatcgttgcc attcccaaaa ctgtgagaag agagaggatg   720
 721 aaagaaaaca tcagcatctt cgattttgaa ctcacacagg aagacatgga aaagattgca   780
 781 acgctcgatg aagggcagag tgcgttcttc tcccacaggg atcccgaggt tgtcaagtgg   840
 841 atttgttcac tgaaaaga   858

Residues: 286 aa
Molecule Weight: 33242.76 Dalton
Number of Met residues: 10
Percentage of Met residues: 3.50 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu