LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0828    Target Constructs

Accession: TM0828
Local acc: TM0828
Description: TM0828 sugar kinase, pfkB family
Organism: THERMOTOGA MARITIMA
Residues: 319 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM0828|1:319 tid:282698 alias: stage:pdb deposition(pdb id:2AJR) Full|1:319 CP Pir/Fasta
MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
PDLEAIKKEYDHFTVERVK
CDS  cDNA 957 bp
   1 atggtcctga cggtgaccct caatcccgct ttagacaggg aaattttcat agaagatttc    60
  61 caggtgaaca ggctgtacag gataaatgat ctttctaaaa ctcaaatgtc cccaggtgga   120
 121 aagggtataa acgtttctat agctctttcc aaattgggag tgccgtcagt cgccaccgga   180
 181 ttcgtgggtg ggtacatggg aaagattctt gtggaagaat tgagaaaaat ttcaaagctg   240
 241 atcacaacga attttgttta cgtggaggga gaaacgaggg aaaacatcga aataatcgat   300
 301 gaaaagaata aaacaataac cgctatcaat tttcccggtc cggatgttac ggatatggat   360
 361 gtgaatcact ttctgagaag atacaagatg acgctttcga aagtcgattg cgttgttata   420
 421 tcggggagta ttccaccggg agtaaacgag ggaatatgca acgaactggt gagactcgcg   480
 481 cgtgaaagag gagtctttgt ctttgtcgaa cagactccca gattgcttga aagaatttat   540
 541 gaggggccag aatttcccaa cgtcgtgaaa ccagatttga gaggtaatca tgcttctttt   600
 601 cttggtgttg atttgaaaac ctttgacgat tacgtgaaac tcgccgaaaa gctcgccgaa   660
 661 aaatcgcagg tttccgtggt gtcatacgaa gtgaagaacg atattgttgc aacaagagaa   720
 721 ggggtctggc ttataagatc caaagaagaa atagacacat cacatcttct gggtgcggga   780
 781 gacgcgtatg tagctggtat ggtctattac ttcattaaac acggagccaa cttcctcgaa   840
 841 atggcaaaat ttggttttgc ctccgcactg gctgccacta gaagaaagga aaaatacatg   900
 901 cccgaccttg aggcgataaa gaaggaatac gatcacttca ccgtagagag ggtgaag   957

Residues: 319 aa
Molecule Weight: 35866.53 Dalton
Number of Met residues: 8
Percentage of Met residues: 2.51 %
Number of Cys residues: 2
Percentage of Cys residues: 0.63 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu