LOADING...
   TM0312;TM0312
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0312    Target Constructs

Accession: TM0312
Local acc: TM0312
Description: TM0312 conserved hypothetical protein
Organism: THERMOTOGA MARITIMA
Residues: 328 aa
Constructs: 1
Warning: the change of start codon from ATG/M to GTG/V(see CP);
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM0312|1:328 tid:282188 alias: stage:pdb deposition(pdb id:1ZH8) Full|1:328 CP Pir/Fasta
VKPLRKIRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSHAEEFAKMVGNPAVFD
SYEELLESGLVDAVDLTLPVELNLPFIEKALRKGVHVICEKPISTDVETGKKVVELSEKS
EKTVYIAENFRHVPAFWKAKELVESGAIGDPVFMNWQIWVGMDENNKYVHTDWRKKPKHV
GGFLSDGGVHHAAAMRLILGEIEWISAVAKDLSPLLGGMDFLSSIFEFENGTVGNYTISY
SLKGNERFEITGTKGKISISWDKIVLNEEEMKVPQENSYQKEFEDFYQVVAEGKPNDLGS
PVQALKDLAFIEACVRSAGNKVFVSSLL
CDS  cDNA 984 bp
   1 gtgaagcctt tgagaaaaat cagattgggt attgtggggt gtggaatcgc cgctcgagag    60
  61 ttgcaccttc ctgccttgaa gaatctttcc catctctttg agatcacggc tgtcacgagt   120
 121 agaacgaggt ctcacgctga agagttcgcg aaaatggtag gaaatcccgc tgttttcgat   180
 181 agctacgaag aacttttgga atctggcctt gttgacgcgg ttgatctaac gctccctgtt   240
 241 gaattgaacc tcccgttcat cgaaaaggcc cttcgaaaag gagtccatgt gatctgtgaa   300
 301 aaacccatct caacggacgt ggaaacagga aagaaggttg tcgagttgtc cgaaaaatct   360
 361 gaaaaaacag tctacatcgc ggagaatttc agacacgttc cggctttctg gaaggcaaaa   420
 421 gagctggttg agagcggagc gataggtgat cccgttttca tgaattggca gatctgggtg   480
 481 ggaatggacg aaaacaacaa atacgttcac actgactgga gaaagaagcc gaagcacgtt   540
 541 ggaggttttc tctcagacgg aggggtccac cacgctgcgg cgatgagact gatccttggt   600
 601 gagatagaat ggatttccgc cgttgcgaag gatctttctc cgcttcttgg gggaatggat   660
 661 tttctttcct ctatcttcga gttcgaaaac ggcacagttg gaaactacac gatttcttac   720
 721 tctctgaaag ggaacgagcg attcgaaatc acaggaacaa aaggaaagat ttccatatcc   780
 781 tgggacaaga tcgttctgaa cgaagaggaa atgaaagttc cacaggaaaa cagctatcag   840
 841 aaggagttcg aggatttcta tcaggtggtt gcggaaggaa aaccgaacga tctgggaagt   900
 901 ccggttcagg ctctgaaaga tcttgctttc atagaagcat gtgtgaggtc cgcgggaaac   960
 961 aaagtgttcg tttccagtct gttg   984

Residues: 328 aa
Molecule Weight: 36537.08 Dalton
Number of Met residues: 7
Percentage of Met residues: 2.13 %
Number of Cys residues: 3
Percentage of Cys residues: 0.91 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu