LOADING...
   TM0231;TM0231
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0231    Target Constructs

Accession: TM0231
Local acc: TM0231
Description: TM0231 UDP-N-acetylmuramate--alanine ligase (murC)
Organism: THERMOTOGA MARITIMA
Residues: 457 aa
Constructs: 1
Warning: the change of start codon from ATG/M to GTG/V(see CP);
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM0231|1:457 tid:282110 alias: stage:pdb deposition(pdb id:1J6U) Full|1:457 CP Pir/Fasta
VKIHFVGIGGIGMSAVALHEFSNGNDVYGSNIEETERTAYLRKLGIPIFVPHSADNWYDP
DLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVTGTDGKTTTTAMV
AHVLKHLRKSPTVFLGGIMDSLEHGNYEKGNGPVVYELDESEEFFSEFSPNYLIITNARG
DHLENYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKKGTYTLEMRSASR
AEQKAMVEKNGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVLEALEEFRGVHRR
FSIAFHDPETNIYVIDDYAHTPDEIRNLLQTAKEVFENEKIVVIFQPHRYSRLEREDGNF
AKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKLPELEKVISVSEN
TVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK
CDS  cDNA 1371 bp
   1 gtgaaaattc atttcgtagg aattggtgga attggaatga gtgccgtggc tttacacgaa    60
  61 ttctcgaatg gaaacgatgt ttacggttca aatatagagg aaacagaaag aaccgcttat   120
 121 ctaagaaaat taggaattcc gatttttgtg ccacactccg cagacaactg gtacgatccc   180
 181 gatctggtta taaaaacccc cgctgttcgt gacgacaacc cggagatagt acgcgccagg   240
 241 atggaaaggg tcccgatcga aaacagactg cattatttcc gagacactct gaaacgggag   300
 301 aaaaaggaag agttcgctgt aaccggaacc gatggcaaaa ccacgacaac cgctatggtt   360
 361 gcacacgttt tgaaacattt gagaaagtct ccaacggtgt tccttggagg tataatggat   420
 421 tctctcgaac acggaaacta cgagaaagga aacggacctg tagtttacga actcgacgag   480
 481 agcgaagagt ttttctcaga gttctctcca aactatctca taatcacaaa cgccagagga   540
 541 gatcatctgg aaaactacgg caactccctg accagataca gatcggcctt cgaaaagatc   600
 601 agcaggaaca ccgatctggt agtcaccttc gcagaggacg aactcacatc tcatctcggt   660
 661 gatgtaactt ttggcgtgaa gaaaggcaca tacaccctcg agatgagaag tgcctctcgc   720
 721 gccgagcaaa aagcaatggt ggagaaaaat ggaaagagat atctcgaact caaactcaag   780
 781 gttcccggtt ttcacaacgt tttgaacgca ctggcagtga tagcgctttt cgactcgctc   840
 841 gggtacgatc tggcaccagt gctcgaagcg ctggaagaat tccggggagt tcacaggcgt   900
 901 ttttccatcg cgtttcacga tccggaaacg aacatctatg tgatagacga ctacgcccac   960
 961 acaccagatg agataagaaa ccttcttcag acagcaaaag aagtcttcga aaacgaaaaa  1020
1021 atcgtggtga tattccagcc gcaccgatat tccagactgg aaagagaaga cggaaacttc  1080
1081 gcaaaggcgc ttcagctggc ggatgaagtt gtggtcacgg aagtctacga tgcgttcgaa  1140
1141 gagaagaaaa acggcatctc agggaagatg atctgggact ctctcaagtc gctcggtaaa  1200
1201 gaggcatatt tcgttgagaa gcttccagaa ctggaaaagg taatctccgt gagtgagaac  1260
1261 accgtcttcc ttttcgttgg tgccggagat atcatctact cttccagaag gttcgtggaa  1320
1321 cgttatcaga gctccaaaag ttctccttcg cgcgtcctag gatcgaacaa a  1371

Residues: 457 aa
Molecule Weight: 51868.97 Dalton
Number of Met residues: 8
Percentage of Met residues: 1.75 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu