LOADING...
   TM0018;TM0018
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0018    Target Constructs

Accession: TM0018
Local acc: TM0018
Description: TM0018 pyruvate ferredoxin oxidoreductase, beta subunit (porB)
Organism: THERMOTOGA MARITIMA
Residues: 324 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>TM0018|1:324 tid:281899 alias: stage:protein purification Full|1:324 CP Pir/Fasta
MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEV
STSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTY
DIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLK
KNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTV
EISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDEL
QEYVDRRWERLLTLEEVTKDKPIR
CDS  cDNA 972 bp
   1 atgcccgtta acataaaaca gctggcacag gagttcgata agaaagaaat cggtatcaca    60
  61 cagggtcaca ggctctgtcc aggttgtgga gcacccatca cagtgaagtt cgtgatgatg   120
 121 atcgcaagac acctcggata cgaacccgtt gttggactcg caacaggttg tctggaggtt   180
 181 tctacctcca tctatccgta caccgcttgg agcgtacctt acattcacaa cgcctttgaa   240
 241 aacgtggcag caacgatgag cggtgtggaa acggcttaca aagcactgaa aaacaaagga   300
 301 aagatcccag aagacaaaaa atacgccttc attgcttttg gtggagacgg tggaacgtac   360
 361 gatatcggtc ttcagtcact gtccgggatg ctcgaaagag gtcacaaggt gctctacgtc   420
 421 ctctacgaca acgagggata catgaacaca ggaaaccaga gatccggatc cacacccccg   480
 481 ggttcggata ccacgacagc tccagttgga aagaagctcc ctggaaaggt ccagctgaaa   540
 541 aagaacatcg tcgagatcgt agcggctcac gagaacgtct acgcagctac cgcatcgctc   600
 601 tctgaaccca tggacttctt tgccaaggtg gaaaaggcgc tgaacttcga tggaccttct   660
 661 ttccttgcgg tcttctctcc ttgcgtcagg ttctggagag tgaacgacga taaaacagta   720
 721 gaaatatcaa aactcgccgt agaaacgaag tactggcctt tgtacgaagt ggaaagagga   780
 781 gtttacagag tcaccagaaa accgagacag ttcaaacctg tggaggaatt cctgaaggct   840
 841 cagggaaggt tcagaaaact tctttcaaga ccggatgcaa aagaaatcgt agacgaactc   900
 901 caggaatacg tcgacagaag atgggaaaga ctactcacac tggaagaggt tacaaaggac   960
 961 aaaccgatta ga   972

Residues: 324 aa
Molecule Weight: 36383.04 Dalton
Number of Met residues: 7
Percentage of Met residues: 2.16 %
Number of Cys residues: 4
Percentage of Cys residues: 1.23 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu