LOADING...
   NP_904517.1;C.KN20883A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_904517.1    Target Constructs

Accession: NP_904517.1
Local acc: C.KN20883A
Description: gi|34540038|ref|NP_904517.1| immunoreactive 32 kDa antigen PG49 [Porphyromonas gingivalis W83]
Organism: PORPHYROMONAS GINGIVALIS W83
Residues: 333 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>C.KN20883A|30:333 tid:425089 alias: stage:pdb deposition(pdb id:4RDB) fragment|30:333 CP Pir/Fasta
DRSIEISIRVDDFTKTGEAVRYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFT
GGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWS
TDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFK
FRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDAN
GKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKY
EVEI
CDS  cDNA 912 bp
   1 gacagatcca tcgaaatttc tataagggta gatgatttca ccaaaacggg tgaggcagta    60
  61 cgctatgaaa ggaatcaagg aagtgctgcc gaaaggctca ttaccaatct ttacctcttg   120
 121 ttgttcgatc agtcaggggc gaatccggcg aaatactata ttaccggtaa cactttcacc   180
 181 ggagggacct ggcttcctga cgatatgaag gtgaagttgg atatgacaca atccgaggcc   240
 241 ggagagcgca aagtatatgt cgtagccaat gttgataatg cggttaaaac ggctcttgat   300
 301 gctgtcgcta acgaaagcga tttgcagact gtaaagagga cgactgcaat gccgtggtcg   360
 361 accgatatag cctctccttt cctgatgtcc ggaaacaaga cacacgactt cttggccaat   420
 421 cgtcttttgg acaatgtgcc ccttgtgcgt gccattgcca aggtggagct gaatatctcg   480
 481 ctgagtgaga aatttcagat tgtgccgata attgtcaatg gtagtttgag tgagttcaag   540
 541 ttcagatacg taaacttcga caaggagacc tacgtagtga agccaacgac caagccggac   600
 601 aatctcatta gttctgctaa tggtgtttgg cctcagatta cagattggac tgtatggggt   660
 661 gcttccttaa atacttctcc tgctccggat gcgggcacag gttatacatt ggatgcaaat   720
 721 ggcaaggtaa cggcactacg gattgttacc tatctgaatg agcgcgatag caaaggggct   780
 781 acggtagagg tcgcattgcc tcgtgtggat gatggcaccc ttcctcctcc ggaattcggt   840
 841 ccggagcttt atcgtttgcc tttgccggac aagatcctgc gcaatcattg gtacaagtat   900
 901 gaagtcgaga tt   912

Residues: 304 aa
Molecule Weight: 33852.48 Dalton
Number of Met residues: 4
Percentage of Met residues: 1.32 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>C.KN20883A|1:333 tid:425088 alias: stage:protein purification Full|1:333 CP Pir/Fasta MKKYLLYASLLTSVLLFSCSKNNPNEPVEDRSIEISIRVDDFTKTGEAVRYERNQGSAAE RLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANV DNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRA IAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWP QITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDD GTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI CDS cDNA 999 bp 1 atgaaaaagt atttgttata tgcctcgttg ctaacgagtg ttttgctctt ttcctgttca 60 61 aagaacaatc ctaacgagcc ggtggaagac agatccatcg aaatttctat aagggtagat 120 121 gatttcacca aaacgggtga ggcagtacgc tatgaaagga atcaaggaag tgctgccgaa 180 181 aggctcatta ccaatcttta cctcttgttg ttcgatcagt caggggcgaa tccggcgaaa 240 241 tactatatta ccggtaacac tttcaccgga gggacctggc ttcctgacga tatgaaggtg 300 301 aagttggata tgacacaatc cgaggccgga gagcgcaaag tatatgtcgt agccaatgtt 360 361 gataatgcgg ttaaaacggc tcttgatgct gtcgctaacg aaagcgattt gcagactgta 420 421 aagaggacga ctgcaatgcc gtggtcgacc gatatagcct ctcctttcct gatgtccgga 480 481 aacaagacac acgacttctt ggccaatcgt cttttggaca atgtgcccct tgtgcgtgcc 540 541 attgccaagg tggagctgaa tatctcgctg agtgagaaat ttcagattgt gccgataatt 600 601 gtcaatggta gtttgagtga gttcaagttc agatacgtaa acttcgacaa ggagacctac 660 661 gtagtgaagc caacgaccaa gccggacaat ctcattagtt ctgctaatgg tgtttggcct 720 721 cagattacag attggactgt atggggtgct tccttaaata cttctcctgc tccggatgcg 780 781 ggcacaggtt atacattgga tgcaaatggc aaggtaacgg cactacggat tgttacctat 840 841 ctgaatgagc gcgatagcaa aggggctacg gtagaggtcg cattgcctcg tgtggatgat 900 901 ggcacccttc ctcctccgga attcggtccg gagctttatc gtttgccttt gccggacaag 960 961 atcctgcgca atcattggta caagtatgaa gtcgagatt 999 Residues: 333 aa Molecule Weight: 37137.17 Dalton Number of Met residues: 5 Percentage of Met residues: 1.50 % Number of Cys residues: 1 Percentage of Cys residues: 0.30 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu