LOADING...
   NP_811570.1;C.KN13462A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811570.1    Target Constructs

Accession: NP_811570.1
Local acc: C.KN13462A
Description: gi|29348067|ref|NP_811570.1| hypothetical protein BT2657 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 338 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>C.KN13462A|30:338 tid:425067 alias: stage:pdb deposition(pdb id:4QDG) fragment|30:338 CP Pir/Fasta
ERIYEDLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQ
DENYRMKLDLKQGNYHFVAYGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRK
NLHGLYWGELTLATADLYSEGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILF
SYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRK
ADGVEIINIPLINYLLMLKSDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDW
TVRINDIRQ
CDS  cDNA 927 bp
   1 gagcgtatct atgaagatct tgctccatgt ccgcatggcg tgtcactacg cttcatttac    60
  61 gactacaata tggaatatgc caatgcattt gctaagaagg tggattgtct gacattgctg   120
 121 gtctatgatg aaaatggcaa ttatgtggat actcgcatag tgacgggtac ggagttgcag   180
 181 gacgagaact atcgcatgaa gctggacctc aaacaaggaa attatcattt cgtagcttat   240
 241 ggtggtctgg cttgtaataa gagctctttc cttatgaagt atacccccgg agaaggaact   300
 301 ggatataccg atttgcaagt ggaactagat tcggaatgct tgacaaatcc cagacgaaag   360
 361 aacttgcacg gtttgtattg gggtgaactt actctcgcta ctgccgacct ttacagtgaa   420
 421 ggcactgttg agatgatgaa gaacaccaat aatattcgtg ttgtgttgca acaaatgaat   480
 481 ggtgagccgg tagatgataa gaaatttgaa tttgaaatta ccgatgataa tatactgttc   540
 541 agttacgata ataatttgct tgagaatggt atggtgacat acactccatg ggcacaaggg   600
 601 caagcttcgg caggattcac tgatgaggga agagaagtgg tggtagctta tgccgaacta   660
 661 tctacttcac ggttgatggt gcgtgattgg tactcgccta agctgacggt gcgtcgcaaa   720
 721 gcagatggtg tggaaattat caatattcca cttattaact atttgcttat gcttaagagt   780
 781 gatctgtatg caagcatgga ttcgcaggag ttccttgatc gtgaaagtga atggtcaatg   840
 841 atattcttct taagcccgaa tcttgaatgg attaaaactt atattaagat aaacgattgg   900
 901 actgtcagaa tcaacgatat aagacaa   927

Residues: 309 aa
Molecule Weight: 35768.56 Dalton
Number of Met residues: 11
Percentage of Met residues: 3.56 %
Number of Cys residues: 4
Percentage of Cys residues: 1.29 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu