LOADING...
   NP_811172.1;GS13194A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811172.1    Target Constructs

Accession: NP_811172.1
Local acc: GS13194A
Description: gi|29347669|ref|NP_811172.1| hypothetical protein BT2259 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 488 aa
Constructs: 3
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>GS13194A|28:488 tid:386313 alias: stage:pdb deposition(pdb id:4Q69) fragment|28:488 CP Pir/Fasta
DINHDPNTAEKVDPGYLFNYVAVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVY
TISPYSTGNTWKHYYSVGGNNLMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGD
IPFTESWNGTIKYPKFDSQESVLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWM
TLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELI
ELVGGTQILFFASNYMLKPMQERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSS
VVSSYLFRKDAPELIYSCQEQLLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVA
EADIDTYVTGLPELTALTQEKALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQV
PEDATSKELIRRWEYSPEEMTANINAPKESPKIWEKLWFDL
CDS  cDNA 1383 bp
   1 gatatcaacc atgaccccaa tactgccgag aaagttgatc ccggatattt gtttaactat    60
  61 gtagccgtaa actgggccgg aacacgtacc ggtggtgact tctatattcc gttatcaatg   120
 121 agttcacagt gtcaggttga tggtggactt gattatggtg gctgggatga atcggtatat   180
 181 accatttccc cttatagtac aggaaatacg tggaaacatt actactctgt cggtggtaat   240
 241 aacttgatgc tggctattaa aaatgcggaa gaagcagatc cggtgaatca caatgctatt   300
 301 gcacagtgta agattctgtt ggctgaacat atgtatgaag cgacgatgct atggggggat   360
 361 atccctttca ctgaatcttg gaacggaaca attaagtatc cgaaatttga ttctcaggaa   420
 421 agtgtattga atggggtgtt gtcattgctt gatgaagcac tgcagatcat ggatttgaat   480
 481 gatgccaatg cgattgatga atacgatatc tattataaag gtgatatgaa taaatggatg   540
 541 actttggcca aatctttaaa gttcagaaca ctgatggtta tggtggacaa agatccttct   600
 601 aaagctactg ccattggtac gttgttacag gctggaggca tggtatcatc agcatcagat   660
 661 aatttggtgt tcccttattc tgcagaaccg ggtaaccaga atcctaagta tgaacttata   720
 721 gaattggttg gcggtacaca gatattgttt tttgccagca actatatgct gaagccgatg   780
 781 caggaacgta atgacccccg tattccttgt tattttgaac cgggtgccga cggtgtatat   840
 841 agaggcttag gtaaccgtga acctgctgtt actgatgaca aagataatat gttatcatct   900
 901 gttgtgagca gttatctttt cagaaaagat gcaccggagt taatatactc ttgccaggag   960
 961 cagttgcttc tggaagcgga agcttatgcg cgcggtttgg gagttgctca gaatttgtcg  1020
1021 aaggctaatg aattgtataa gaaaggcatt cgggaagcat gtgcatttta tggagtagcg  1080
1081 gaagcggata ttgatacata tgttacaggt ttgccggaat tgacagcgct gactcaggag  1140
1141 aaagcactgt atgagattca tatgcagcag tggattgatt taatggatcg tccgtttgag  1200
1201 gagtttgtac agtggagacg ttctggtact gctggaaatg aagtcccgac cttacaagtg  1260
1261 ccggaagatg caacttcaaa agaactgatc agaagatggg agtatagccc ggaagagatg  1320
1321 actgctaata tcaatgcacc gaaagaatct ccgaaaattt gggaaaagtt atggtttgat  1380
1381 tta  1383

Residues: 461 aa
Molecule Weight: 51873.65 Dalton
Number of Met residues: 16
Percentage of Met residues: 3.47 %
Number of Cys residues: 5
Percentage of Cys residues: 1.08 %

>GS13194A|1:488 tid:384616 alias: stage:proposed target Full|1:488 CP Pir/Fasta MIMKKKILAYALSALTCGLFTSCSDWLDINHDPNTAEKVDPGYLFNYVAVNWAGTRTGGD FYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEAD PVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEA LQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGG MVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFE PGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGL GVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWID LMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKI WEKLWFDL CDS cDNA 1464 bp 1 atgattatga aaaagaaaat attagcatat gcattgagcg ctttgacatg tgggttattt 60 61 acttcatgca gcgactggct tgatatcaac catgacccca atactgccga gaaagttgat 120 121 cccggatatt tgtttaacta tgtagccgta aactgggccg gaacacgtac cggtggtgac 180 181 ttctatattc cgttatcaat gagttcacag tgtcaggttg atggtggact tgattatggt 240 241 ggctgggatg aatcggtata taccatttcc ccttatagta caggaaatac gtggaaacat 300 301 tactactctg tcggtggtaa taacttgatg ctggctatta aaaatgcgga agaagcagat 360 361 ccggtgaatc acaatgctat tgcacagtgt aagattctgt tggctgaaca tatgtatgaa 420 421 gcgacgatgc tatgggggga tatccctttc actgaatctt ggaacggaac aattaagtat 480 481 ccgaaatttg attctcagga aagtgtattg aatggggtgt tgtcattgct tgatgaagca 540 541 ctgcagatca tggatttgaa tgatgccaat gcgattgatg aatacgatat ctattataaa 600 601 ggtgatatga ataaatggat gactttggcc aaatctttaa agttcagaac actgatggtt 660 661 atggtggaca aagatccttc taaagctact gccattggta cgttgttaca ggctggaggc 720 721 atggtatcat cagcatcaga taatttggtg ttcccttatt ctgcagaacc gggtaaccag 780 781 aatcctaagt atgaacttat agaattggtt ggcggtacac agatattgtt ttttgccagc 840 841 aactatatgc tgaagccgat gcaggaacgt aatgaccccc gtattccttg ttattttgaa 900 901 ccgggtgccg acggtgtata tagaggctta ggtaaccgtg aacctgctgt tactgatgac 960 961 aaagataata tgttatcatc tgttgtgagc agttatcttt tcagaaaaga tgcaccggag 1020 1021 ttaatatact cttgccagga gcagttgctt ctggaagcgg aagcttatgc gcgcggtttg 1080 1081 ggagttgctc agaatttgtc gaaggctaat gaattgtata agaaaggcat tcgggaagca 1140 1141 tgtgcatttt atggagtagc ggaagcggat attgatacat atgttacagg tttgccggaa 1200 1201 ttgacagcgc tgactcagga gaaagcactg tatgagattc atatgcagca gtggattgat 1260 1261 ttaatggatc gtccgtttga ggagtttgta cagtggagac gttctggtac tgctggaaat 1320 1321 gaagtcccga ccttacaagt gccggaagat gcaacttcaa aagaactgat cagaagatgg 1380 1381 gagtatagcc cggaagagat gactgctaat atcaatgcac cgaaagaatc tccgaaaatt 1440 1441 tgggaaaagt tatggtttga ttta 1464 Residues: 488 aa Molecule Weight: 54864.15 Dalton Number of Met residues: 18 Percentage of Met residues: 3.69 % Number of Cys residues: 7 Percentage of Cys residues: 1.43 %

>GS13194A|1:488 tid:409022 alias: stage:proposed target Full|1:488 CP Pir/Fasta MIMKKKILAYALSALTCGLFTSCSDWLDINHDPNTAEKVDPGYLFNYVAVNWAGTRTGGD FYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEAD PVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEA LQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGG MVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFE PGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGL GVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWID LMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKI WEKLWFDL CDS cDNA 1464 bp 1 atgattatga aaaagaaaat attagcatat gcattgagcg ctttgacatg tgggttattt 60 61 acttcatgca gcgactggct tgatatcaac catgacccca atactgccga gaaagttgat 120 121 cccggatatt tgtttaacta tgtagccgta aactgggccg gaacacgtac cggtggtgac 180 181 ttctatattc cgttatcaat gagttcacag tgtcaggttg atggtggact tgattatggt 240 241 ggctgggatg aatcggtata taccatttcc ccttatagta caggaaatac gtggaaacat 300 301 tactactctg tcggtggtaa taacttgatg ctggctatta aaaatgcgga agaagcagat 360 361 ccggtgaatc acaatgctat tgcacagtgt aagattctgt tggctgaaca tatgtatgaa 420 421 gcgacgatgc tatgggggga tatccctttc actgaatctt ggaacggaac aattaagtat 480 481 ccgaaatttg attctcagga aagtgtattg aatggggtgt tgtcattgct tgatgaagca 540 541 ctgcagatca tggatttgaa tgatgccaat gcgattgatg aatacgatat ctattataaa 600 601 ggtgatatga ataaatggat gactttggcc aaatctttaa agttcagaac actgatggtt 660 661 atggtggaca aagatccttc taaagctact gccattggta cgttgttaca ggctggaggc 720 721 atggtatcat cagcatcaga taatttggtg ttcccttatt ctgcagaacc gggtaaccag 780 781 aatcctaagt atgaacttat agaattggtt ggcggtacac agatattgtt ttttgccagc 840 841 aactatatgc tgaagccgat gcaggaacgt aatgaccccc gtattccttg ttattttgaa 900 901 ccgggtgccg acggtgtata tagaggctta ggtaaccgtg aacctgctgt tactgatgac 960 961 aaagataata tgttatcatc tgttgtgagc agttatcttt tcagaaaaga tgcaccggag 1020 1021 ttaatatact cttgccagga gcagttgctt ctggaagcgg aagcttatgc gcgcggtttg 1080 1081 ggagttgctc agaatttgtc gaaggctaat gaattgtata agaaaggcat tcgggaagca 1140 1141 tgtgcatttt atggagtagc ggaagcggat attgatacat atgttacagg tttgccggaa 1200 1201 ttgacagcgc tgactcagga gaaagcactg tatgagattc atatgcagca gtggattgat 1260 1261 ttaatggatc gtccgtttga ggagtttgta cagtggagac gttctggtac tgctggaaat 1320 1321 gaagtcccga ccttacaagt gccggaagat gcaacttcaa aagaactgat cagaagatgg 1380 1381 gagtatagcc cggaagagat gactgctaat atcaatgcac cgaaagaatc tccgaaaatt 1440 1441 tgggaaaagt tatggtttga ttta 1464 Residues: 488 aa Molecule Weight: 54864.15 Dalton Number of Met residues: 18 Percentage of Met residues: 3.69 % Number of Cys residues: 7 Percentage of Cys residues: 1.43 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu