LOADING...
   NP_810851.1;FR15002A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810851.1    Target Constructs

Accession: NP_810851.1
Local acc: FR15002A
Description: gi|29347348|ref|NP_810851.1| hypothetical protein BT1938 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 399 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>FR15002A|1:399 tid:392884 alias: stage:pdb deposition(pdb id:4NPG) Full|1:399 CP Pir/Fasta
MSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTDNSVKVDGIIPGI
YSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLIFKEIYYCGSRPE
KGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADGNNYAYGERVWKF
PGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNNPNFPDQAAYDMQ
HVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTDLSKPNSNVYYAK
IPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKLSTDEEGNPIIRE
ETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL
CDS  cDNA 1197 bp
   1 atgtctggca cagcagaagt gaatcctatc acagtggatg tatatttgga tattaccgtt    60
  61 gaaaatatat ccacactgaa agatctgact gtaaagttcg acaattacga tgaagattta   120
 121 cattatgtaa aagaagtaac tgataatagt gtgaaagttg acggaattat ccccggaatt   180
 181 tattcggtaa cagtatccgg tacagcgatc gatacagaaa acaatgaata ctacatcaat   240
 241 ggcaattctg taaatgcggc attatttaag catggtagcg cattgaatat tgaagtacaa   300
 301 gggcttaaag tgagcccatt aatattcaag gagatttatt attgcggtag ccgtccggaa   360
 361 aaaggaggag tctatttccg agaccagttc tatgagatat acaataactc tgctgacatt   420
 421 ttgtatttgg acggtattta tttcgcaaat ttaactccgg gtacagctac cactaaatta   480
 481 cctatttggc cggaagcgga cggtaataat tatgcatatg gagaacgtgt gtggaaattt   540
 541 ccaggaaatg gaaccgaata tccgttagcg ccaggtgaat cttgcatcat ttctcaattt   600
 601 gccgctaacc atcagttgga catctataac cctcaaagtc ctatagacgg cagtagttct   660
 661 gagtttgagt ttaatatgaa taatccaaac ttccctgacc aggcagctta tgatatgcaa   720
 721 catgttttct accaaggaaa agcagagatg ggaagtatac cacaatattt gacatccgta   780
 781 ttcggaggtg cttatgtgat ttttcgtgtt cctgaaggag aagcttggga tccggtcaac   840
 841 gatgaaaata tgaagacaac agatcttagc aaaccgaaca gcaatgttta ttatgcaaaa   900
 901 atacctatta aatatgtatt ggatgctgtt gaagcagtaa acaatgagtc aaagatgaat   960
 961 gcaaaacgtg tccccggtgt acttgatgca ggtattactt gggtaggagc tacttattgc  1020
1021 ggtttaggta ttgctcgcaa attgtccaca gacgaagaag gtaatcctat tattcgcgaa  1080
1081 gaaacaggta catatatata tcaggataca aacaacagta cggatgactt tgaacgtggc  1140
1141 gttgttcctg taatgcgtcg taatggagca aaaatgcctt catggaatca cacattg  1197

Residues: 399 aa
Molecule Weight: 44384.11 Dalton
Number of Met residues: 8
Percentage of Met residues: 2.01 %
Number of Cys residues: 3
Percentage of Cys residues: 0.75 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu