LOADING...
   NP_809759.1;SP16701A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809759.1    Target Constructs

Accession: NP_809759.1
Local acc: SP16701A
Description: gi|29346256|ref|NP_809759.1| hypothetical protein BT0846 [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 119 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP16701A|22:119 tid:417790 alias: stage:pdb deposition(pdb id:2M4L) fragment|22:119 CP Pir/Fasta
EDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIY
IYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK
CDS  cDNA 294 bp
   1 gaagattgga ctgaacttaa cagcaataac attataggtt attggtcgac aggaatcgaa    60
  61 ggtactcaca aattattaag tttcgatgag gatggtactg gctcttttgg aatttacagc   120
 121 aatgctactc caatttcctt tcaaatgttc gattataaaa tcgaggaagg tagaatctat   180
 181 atttatgatg tatatccaga tgaaaagact ccatattatt tagattgtaa gatatcaggc   240
 241 acgactctta aagtcgaaac cggaagtgaa gctggaacct ataagaagca aaaa   294

Residues: 98 aa
Molecule Weight: 11174.75 Dalton
Number of Met residues: 1
Percentage of Met residues: 1.02 %
Number of Cys residues: 1
Percentage of Cys residues: 1.02 %

>SP16701A|1:119 tid:409160 alias: stage:proposed target Full|1:119 CP Pir/Fasta MKNILFTLFAILILTSCSKDEEDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIY SNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK CDS cDNA 357 bp 1 atgaaaaaca ttttattcac actttttgct attctcatct taactagctg cagcaaagat 60 61 gaagaagatt ggactgaact taacagcaat aacattatag gttattggtc gacaggaatc 120 121 gaaggtactc acaaattatt aagtttcgat gaggatggta ctggctcttt tggaatttac 180 181 agcaatgcta ctccaatttc ctttcaaatg ttcgattata aaatcgagga aggtagaatc 240 241 tatatttatg atgtatatcc agatgaaaag actccatatt atttagattg taagatatca 300 301 ggcacgactc ttaaagtcga aaccggaagt gaagctggaa cctataagaa gcaaaaa 357 Residues: 119 aa Molecule Weight: 13557.50 Dalton Number of Met residues: 2 Percentage of Met residues: 1.68 % Number of Cys residues: 2 Percentage of Cys residues: 1.68 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu