LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1    Target Constructs

Accession: NP_809341.1
Local acc: GE2184A
Description: gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 435 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>GE2184A|1:435 tid:396691 alias: stage:pdb deposition(pdb id:3QOV) Full|1:435 CP Pir/Fasta
MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
SEGKAVRVKDLRDNK
CDS  cDNA 1305 bp
   1 atgagtacac aatactggga agaagaaatt gaaatcatga gtcgcgagaa gttgcaggaa    60
  61 ctgcaacttc agcgactcaa aaaaacgatt aacatagccg caaactcacc ttattacaaa   120
 121 gaggttttca gcaaaaacgg catcaccgga gatagtatcc agtcactgga cgacatccgc   180
 181 aaaattcctt tcaccactaa atcggacatg cgtgccaact atcccttcgg gctagtggcc   240
 241 ggcgacatga aaagagacgg tgtacgtatc cactcttcca gtggaactac aggaaaccct   300
 301 acagtcatcg tacattcaca acatgacctc gactcatggg caaatctggt agcccgttgc   360
 361 ctttacatgg tggggatccg caagacagat gtcttccaga acagctccgg atatggaatg   420
 421 tttacaggtg gattaggttt tcaatatggt gcagaacgcc ttggctgcct taccgtacct   480
 481 gccgcagccg gaaacagtaa acggcaaatt aaattcatca gtgactttaa gactaccgcc   540
 541 ttacacgcca tcccaagcta cgctatccgt cttgccgaag tatttcagga agaaggtatc   600
 601 gacccgagag aaacaaccct gaaaaccttg gtgatcggcg ccgaaccgca tactgacgaa   660
 661 cagcgccgta aaatagaacg gatgctcaat gtgaaagcat ataatagttt cggtatgacg   720
 721 gaaatgaacg gccccggtgt tgccttcgaa tgccaggagc agaacggaat gcacttctgg   780
 781 gaagattgct atctggtaga aatcatcgat cctgaaacag gagaacccgt tcccgaagga   840
 841 gaaatcggtg aattggtact cactacactt gatcgtgaaa tgatgccgct tatccgctac   900
 901 cgcacccgcg accttacccg tatactaccc ggaaaatgtc cgtgcggccg cacccatctc   960
 961 cgcatcgacc ggatcaaggg acgcagcgac gatatgttta tcatcaaggg agtcaacatc  1020
1021 ttccccatgc aagtcgaaaa gattctggtt cagttccccg aattaggcag caattatctg  1080
1081 attacgctgg agacagtcaa caatcaggat gagatgatcg tcgaagtgga attaagcgat  1140
1141 ctttctacag acaactatat cgaactggaa aagatccgca gagatattat ccgtcaatta  1200
1201 aaagatgaaa tactggttac cccgaaagta aaactagtaa agaaagggtc tctcccgcag  1260
1261 agcgagggaa aagccgtcag agtgaaggac ttaagagaca acaaa  1305

Residues: 435 aa
Molecule Weight: 49377.07 Dalton
Number of Met residues: 15
Percentage of Met residues: 3.45 %
Number of Cys residues: 6
Percentage of Cys residues: 1.38 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu