LOADING...
   NP_638301.1;FK8795C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_638301.1    Target Constructs

Accession: NP_638301.1
Local acc: FK8795C
Description: gi|21232384|ref|NP_638301.1| hypothetical protein XCC2953 [Xanthomonas campestris pv. campestris str. ATCC 33913]
Organism: XANTHOMONAS CAMPESTRIS
Residues: 141 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>FK8795C|1:141 tid:371737 alias: stage:pdb deposition(pdb id:2OZH) Full|1:141 CP Pir/Fasta
MPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFAR
VISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYG
FTPPLFPQSLMERYVPGLYST
CDS  cDNA 423 bp
   1 atgccgcacg tgcacgtcag caccgacaac tccctgctcg atatcggctt gatccatcgc    60
  61 acgctgtcac aagacaccga ttgggccaag gacattcccc tcgcccttgt gcagcgcgcg   120
 121 atcgatcatt cgttgtgctt cggcgggttt gtcgatggcc ggcaagtcgc gttcgccagg   180
 181 gtgatttccg actatgcgac ctttgcgtac ctgggcgatg tgttcgtgct gccggagcac   240
 241 cgcggccgcg gctacagcaa ggcgctgatg gatgcggtca tggcgcatcc cgatctgcag   300
 301 gggctacgcc gcttcagcct ggccaccagt gatgcgcatg gcctgtacgc ccgctacggg   360
 361 tttacgccgc cattgtttcc gcagtcgttg atggagcggt atgttcctgg gttgtattcg   420
 421 acc   423

Residues: 141 aa
Molecule Weight: 15711.06 Dalton
Number of Met residues: 4
Percentage of Met residues: 2.84 %
Number of Cys residues: 1
Percentage of Cys residues: 0.71 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu