LOADING...
   NP_463836.1;MJ14477B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_463836.1    Target Constructs

Accession: NP_463836.1
Local acc: MJ14477B
Description: gi|16802351|ref|NP_463836.1| similar to low specificity L-allo-threonine aldolase [Listeria monocytogenes EGD-e]
Organism: LISTERIA MONOCYTOGENES EGD-E
Residues: 358 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>MJ14477B|1:358 tid:403100 alias: stage:pdb deposition(pdb id:3PJ0) Full|1:358 CP Pir/Fasta
MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGNGAVIEDFETKIAKIL
GKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGT
ANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARL
WEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLIS
LYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSAD
EIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL
CDS  cDNA 1074 bp
   1 atgacaaaca cactaaaaac cagttaccaa aaaacacctt ataaactagg cgggaatggc    60
  61 ccgcgcaatg tgggtgtttt aacagaagca cttcaaaata tagatgataa tttagaaagc   120
 121 gatatttacg gaaacggtgc agttattgaa gactttgaaa caaaaatcgc gaaaattctc   180
 181 gggaaacaat ctgcggtatt tttcccaagt gggacgatgg cacaacaaat cgcgttaagg   240
 241 atttgggctg accggaaaga gaatcggcgc gtagcatatc atccgctctc tcatttggag   300
 301 attcatgagc aagatgggct aaaagaattg cagcaaatca cgccactatt acttggtaca   360
 361 gcgaatcagc ttttgacaat tgacgatatt aaaagtcttc gcgagccagt ttctagtgtg   420
 421 cttatcgaac ttcctcaacg agaaattggt gggcaactac ctgcttttga agagcttgag   480
 481 aagatttcag agtattgcca tgaacagggt atttcgttgc atctggacgg ggcgcggtta   540
 541 tgggaaatta cgccgtttta tcagaagtct gcggaagaaa tttgtgcgct gtttgatagt   600
 601 gtgtatgtgt cgttttataa agggattggc gggattgctg gggcgatttt ggctgggaat   660
 661 gatgattttg tgcaagaggc gaaaatctgg aaacgacggt atggcgggga tttgattagt   720
 721 ctgtatccat atattttgtc cgcggattat tattttgaaa aacggattgg gaaaatggcg   780
 781 gagtattttg aagcggcgaa aggattggct gagcgattta attcgtgttc gggcgtgaag   840
 841 actgtgccgg aagtgccggt ttctaatatg tttcatgttt attttgagaa ttcggctgat   900
 901 gagattgggg caattttgac gaagattcag gatgaaactg gcgttgggat ttcggggtat   960
 961 ttgcaggaga aatcagcgga tgtttgtgcg tttgaggttt cggttgggga tgcgtttgcg  1020
1021 gaaataccag caaaaaattt agaactagtt tttagatgtt tggaaaagga actt  1074

Residues: 358 aa
Molecule Weight: 39896.18 Dalton
Number of Met residues: 4
Percentage of Met residues: 1.12 %
Number of Cys residues: 5
Percentage of Cys residues: 1.40 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu