LOADING...
   NP_370957.1;SP17980D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_370957.1    Target Constructs

Accession: NP_370957.1
Local acc: SP17980D
Description: gi|15923423|ref|NP_370957.1| exotoxin 15 [Staphylococcus aureus subsp. aureus Mu50]
Organism: STAPHYLOCOCCUS AUREUS MU50
Residues: 227 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP17980D|31:227 tid:417440 alias: stage:pdb deposition(pdb id:3O13) fragment|31:227 CP Pir/Fasta
STLEVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDD
DEVSNVDVFVVREGSDKSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSE
YYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHR
MGDTIDSRNIEKIEVNL
CDS  cDNA 591 bp
   1 agtacattag aggttagatc acaagctact caagacttga gtgaatatta taaagggaga    60
  61 ggatttgaat taacaaatgt aacaggatat aaatacggaa ataaagttac atttatagat   120
 121 aattctcaac aaattgatgt tacattgaca ggaaatgaaa aattaactgt taaagatgat   180
 181 gacgaagttt ctaatgttga cgtgtttgta gtaagagaag gtagtgacaa atcagctatc   240
 241 acaacatcga ttggtggaat tacaaagaca aatgggactc aacataaaga tactgttcaa   300
 301 aacgttaatt tgtcagtttc taagagtaca ggtcaacaca ctacttctgt gacttcagaa   360
 361 tactatagca tctataaaga agaaatctca ttaaaagaac ttgattttaa attaagaaag   420
 421 catttaattg ataaacatga tctttataag acagaaccta aagacagtaa aattagaatt   480
 481 actatgaaaa acggtggcta ttatacattt gaattaaata aaaaattaca gcctcatcgc   540
 541 atgggtgata cgattgatag tagaaatata gagaaaattg aagtgaattt a   591

Residues: 197 aa
Molecule Weight: 22370.86 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.02 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP17980D|1:227 tid:413588 alias: stage:proposed target Full|1:227 CP Pir/Fasta MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYKGRGFELTNVTGY KYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSDKSAITTSIGGITKT NGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYK TEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL CDS cDNA 681 bp 1 atgaaattaa aaaatattgc taaagcaagt ttagcactag ggattttaac aacaggtatg 60 61 attacaacta ctgctcagcc agtaaaagca agtacattag aggttagatc acaagctact 120 121 caagacttga gtgaatatta taaagggaga ggatttgaat taacaaatgt aacaggatat 180 181 aaatacggaa ataaagttac atttatagat aattctcaac aaattgatgt tacattgaca 240 241 ggaaatgaaa aattaactgt taaagatgat gacgaagttt ctaatgttga cgtgtttgta 300 301 gtaagagaag gtagtgacaa atcagctatc acaacatcga ttggtggaat tacaaagaca 360 361 aatgggactc aacataaaga tactgttcaa aacgttaatt tgtcagtttc taagagtaca 420 421 ggtcaacaca ctacttctgt gacttcagaa tactatagca tctataaaga agaaatctca 480 481 ttaaaagaac ttgattttaa attaagaaag catttaattg ataaacatga tctttataag 540 541 acagaaccta aagacagtaa aattagaatt actatgaaaa acggtggcta ttatacattt 600 601 gaattaaata aaaaattaca gcctcatcgc atgggtgata cgattgatag tagaaatata 660 661 gagaaaattg aagtgaattt a 681 Residues: 227 aa Molecule Weight: 25438.46 Dalton Number of Met residues: 4 Percentage of Met residues: 1.76 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu