LOADING...
   NP_253659.1;SP19119A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_253659.1    Target Constructs

Accession: NP_253659.1
Local acc: SP19119A
Description: gi|15600165|ref|NP_253659.1| hypothetical protein [Pseudomonas aeruginosa PA01]
Organism: PSEUDOMONAS AERUGINOSA
Residues: 248 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP19119A|24:248 tid:417344 alias: stage:pdb deposition(pdb id:4E72) fragment|24:248 CP Pir/Fasta
KPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNE
TPLPASLAAYERQFLDSAEPGWSSYLQAKVREQHDGLVIIELSSYLFTGGAHGMPGRGFI
NYDRRQHKVLSLQDMLVPGQEEAFWKQAELAHKAWLLANKLDQDADFQKTWPFQRTPHVA
LTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG
CDS  cDNA 675 bp
   1 aagcccggcc tcgacgaccc gctgcccacc gagcgcctcg ccagcgagca cctgaagccc    60
  61 ggctgtcagg gcgaacagtg tcccttggta aacatcgaca ccttgaagtt ccccgacgaa   120
 121 ccgcagttgg acccgatcgt cgagcgcgcc ctgctggaaa tgacccggga aaacaacgaa   180
 181 acgcccctgc cggcatcgct ggcggcctac gagcggcagt tcctggacag cgccgagccg   240
 241 ggctggagca gctacctgca agccaaggtg cgcgaacaac atgacggtct ggtgatcatc   300
 301 gagctttcca gctacctgtt caccggcggc gcccacggca tgcccggtcg cggcttcatc   360
 361 aactacgacc gcaggcagca caaggtgctg agcctgcagg acatgctggt tcccggccag   420
 421 gaagaagcct tctggaaaca ggccgagctg gcgcacaagg cctggctgct ggccaacaag   480
 481 ctcgaccagg acgccgattt ccagaagacc tggccgttcc agcgcacccc gcacgtggca   540
 541 ttgaccttcg gcgcggtgac gctgaagtac gacgcctact ccatcgcgcc gtattcctat   600
 601 gcccaccccg aactgaagat cccgtatccg cgcctgaacg gcatcgtcaa gccgaacctg   660
 661 ttccccggcc gcggc   675

Residues: 225 aa
Molecule Weight: 25389.50 Dalton
Number of Met residues: 3
Percentage of Met residues: 1.33 %
Number of Cys residues: 2
Percentage of Cys residues: 0.89 %

>SP19119A|1:248 tid:413327 alias: stage:proposed target Full|1:248 CP Pir/Fasta MRLLKFAALGSLVVLLSACQSLFKPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKF PDEPQLDPIVERALLEMTRENNETPLPASLAAYERQFLDSAEPGWSSYLQAKVREQHDGL VIIELSSYLFTGGAHGMPGRGFINYDRRQHKVLSLQDMLVPGQEEAFWKQAELAHKAWLL ANKLDQDADFQKTWPFQRTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVK PNLFPGRG CDS cDNA 744 bp 1 atgcgccttc tgaaattcgc cgccctcggc agcctggtcg ttctgctgag cgcctgccag 60 61 agcctcttca agcccggcct cgacgacccg ctgcccaccg agcgcctcgc cagcgagcac 120 121 ctgaagcccg gctgtcaggg cgaacagtgt cccttggtaa acatcgacac cttgaagttc 180 181 cccgacgaac cgcagttgga cccgatcgtc gagcgcgccc tgctggaaat gacccgggaa 240 241 aacaacgaaa cgcccctgcc ggcatcgctg gcggcctacg agcggcagtt cctggacagc 300 301 gccgagccgg gctggagcag ctacctgcaa gccaaggtgc gcgaacaaca tgacggtctg 360 361 gtgatcatcg agctttccag ctacctgttc accggcggcg cccacggcat gcccggtcgc 420 421 ggcttcatca actacgaccg caggcagcac aaggtgctga gcctgcagga catgctggtt 480 481 cccggccagg aagaagcctt ctggaaacag gccgagctgg cgcacaaggc ctggctgctg 540 541 gccaacaagc tcgaccagga cgccgatttc cagaagacct ggccgttcca gcgcaccccg 600 601 cacgtggcat tgaccttcgg cgcggtgacg ctgaagtacg acgcctactc catcgcgccg 660 661 tattcctatg cccaccccga actgaagatc ccgtatccgc gcctgaacgg catcgtcaag 720 721 ccgaacctgt tccccggccg cggc 744 Residues: 248 aa Molecule Weight: 27852.42 Dalton Number of Met residues: 4 Percentage of Met residues: 1.61 % Number of Cys residues: 3 Percentage of Cys residues: 1.21 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu