LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1    Target Constructs

Accession: NP_251743.1
Local acc: SP16046A
Description: gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
Organism: PSEUDOMONAS AERUGINOSA
Residues: 335 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP16046A|22:335 tid:419247 alias: stage:pdb deposition(pdb id:4F0J) fragment|22:335 CP Pir/Fasta
SQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVAPKKANGRTILLMHGKNFCAGT
WERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQLAANTHALLERLGVARASVIGH
SMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQY
QQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSALTYDMIFTQPVVYELDRLQMPT
LLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRIPQATLVEFPDLGHTPQIQAPE
RFHQALLEGLQTQP
CDS  cDNA 942 bp
   1 agccaggcgc cggtctacgg cgaacgcctg gaaggcttcg actacgccta tccggtgcat    60
  61 tatctggact tcacctccca gggccagccg ctgagcatgg cctacctcga cgtcgcgccg   120
 121 aagaaagcca acggccgcac catcctgctc atgcacggca agaatttctg cgccgggacc   180
 181 tgggagcgca ccatcgacgt gctcgccgac gccggctacc gggtgatcgc cgtcgaccag   240
 241 gtcggtttct gcaagtcgag caagccggcc cattaccagt acagcttcca gcaactggca   300
 301 gccaacaccc acgccctgct ggaacggctc ggcgtcgccc gggccagcgt gatcggccac   360
 361 tccatgggcg gcatgctcgc tacccgctac gccctgctct atccgcggca ggtcgaacga   420
 421 ctggtgctgg tcaaccccat cggtctggag gactggaagg ccctgggcgt gccctggcgc   480
 481 agcgtcgacg actggtacag gcgcgacttg cagaccagcg ccgaaggcat tcgccaatac   540
 541 cagcaagcca cctactacgc cggcgaatgg cgccccgagt tcgatcgctg ggtacagatg   600
 601 caggccggca tgtatcgcgg caaggggcgc gagtcggtgg cctggaactc ggcgctgacc   660
 661 tacgacatga tcttcaccca gccggtggtc tacgaactgg accggttgca gatgccgacc   720
 721 ctgctgctga tcggcgagaa agacaacacc gccatcggca aggacgccgc gccggcagaa   780
 781 ctgaaagcca ggctgggcaa ctacgcgcaa ctgggcaagg acgccgccag acggattccc   840
 841 caggcgaccc tggtggaatt ccccgacctt ggccataccc cgcagataca ggctccggaa   900
 901 cgcttccacc aggcactgct ggagggtctg caaacccagc cc   942

Residues: 314 aa
Molecule Weight: 35400.46 Dalton
Number of Met residues: 8
Percentage of Met residues: 2.55 %
Number of Cys residues: 2
Percentage of Cys residues: 0.64 %

>SP16046A|1:335 tid:413214 alias: stage:proposed target Full|1:335 CP Pir/Fasta MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP CDS cDNA 1005 bp 1 atgtccctac cccgcctcag cctcagcctc tgtctcgccc tcgcctgcgg gccggcgctg 60 61 gccagccagg cgccggtcta cggcgaacgc ctggaaggct tcgactacgc ctatccggtg 120 121 cattatctgg acttcacctc ccagggccag ccgctgagca tggcctacct cgacgtcgcg 180 181 ccgaagaaag ccaacggccg caccatcctg ctcatgcacg gcaagaattt ctgcgccggg 240 241 acctgggagc gcaccatcga cgtgctcgcc gacgccggct accgggtgat cgccgtcgac 300 301 caggtcggtt tctgcaagtc gagcaagccg gcccattacc agtacagctt ccagcaactg 360 361 gcagccaaca cccacgccct gctggaacgg ctcggcgtcg cccgggccag cgtgatcggc 420 421 cactccatgg gcggcatgct cgctacccgc tacgccctgc tctatccgcg gcaggtcgaa 480 481 cgactggtgc tggtcaaccc catcggtctg gaggactgga aggccctggg cgtgccctgg 540 541 cgcagcgtcg acgactggta caggcgcgac ttgcagacca gcgccgaagg cattcgccaa 600 601 taccagcaag ccacctacta cgccggcgaa tggcgccccg agttcgatcg ctgggtacag 660 661 atgcaggccg gcatgtatcg cggcaagggg cgcgagtcgg tggcctggaa ctcggcgctg 720 721 acctacgaca tgatcttcac ccagccggtg gtctacgaac tggaccggtt gcagatgccg 780 781 accctgctgc tgatcggcga gaaagacaac accgccatcg gcaaggacgc cgcgccggca 840 841 gaactgaaag ccaggctggg caactacgcg caactgggca aggacgccgc cagacggatt 900 901 ccccaggcga ccctggtgga attccccgac cttggccata ccccgcagat acaggctccg 960 961 gaacgcttcc accaggcact gctggagggt ctgcaaaccc agccc 1005 Residues: 335 aa Molecule Weight: 37482.90 Dalton Number of Met residues: 9 Percentage of Met residues: 2.69 % Number of Cys residues: 4 Percentage of Cys residues: 1.19 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu