LOADING...
   NM_002092;NM_002092
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002092    Target Constructs

Accession: NM_002092
Local acc: WS.B3220B
Description: NM_002092 Homo sapiens G-rich RNA sequence binding factor 1 (GRSF1), transcript variant 1, mRNA, coding region:84-1526
Organism: HOMO SAPIENS
Residues: 480 aa
Constructs: 4
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>WS.B3220B|400:480 tid:429317 alias: stage:pdb deposition(pdb id:4QU7) fragment|400:480 CP Pir/Fasta
LHFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLK
DRSHVHHRYIELFLNSCPKGK
CDS  cDNA 243 bp
   1 ctgcattttg tccacatgag aggattacct ttccaagcca atgcccaaga cattataaac    60
  61 ttttttgctc cactcaagcc tgttagaatc accatggaat acagctccag tgggaaggcc   120
 121 actggagaag ctgatgtgca ctttgagacc catgaggatg ctgttgcagc gatgctcaag   180
 181 gatcggtccc acgttcatca taggtatatt gaactgttcc tgaattcatg tccaaaagga   240
 241 aaa   243

Residues: 81 aa
Molecule Weight: 9205.06 Dalton
Number of Met residues: 3
Percentage of Met residues: 3.70 %
Number of Cys residues: 1
Percentage of Cys residues: 1.23 %

>WS.B3220B|401:475 tid:430175 alias: stage:truncating fragment|401:475 CP Pir/Fasta HFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKD RSHVHHRYIELFLNS CDS cDNA 225 bp 1 cattttgtcc acatgagagg attacctttc caagccaatg cccaagacat tataaacttt 60 61 tttgctccac tcaagcctgt tagaatcacc atggaataca gctccagtgg gaaggccact 120 121 ggagaagctg atgtgcactt tgagacccat gaggatgctg ttgcagcgat gctcaaggat 180 181 cggtcccacg ttcatcatag gtatattgaa ctgttcctga attca 225 Residues: 75 aa Molecule Weight: 8578.28 Dalton Number of Met residues: 3 Percentage of Met residues: 4.00 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WS.B3220B|250:330 tid:430375 alias: stage:screening fragment|250:330 CP Pir/Fasta GVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRRKTGEAYVQFEEPEMANQALLK HREEIGNRYIEIFPSRRNEVR CDS cDNA 243 bp 1 ggtgtggttc gtttgagagg acttccttat agttgcaatg agaaagacat tgtagacttc 60 61 tttgcaggac tgaatatagt tgacattact tttgtgatgg actatagagg gaggcgaaaa 120 121 acaggggaag cctatgtgca atttgaagaa ccagaaatgg ccaaccaagc cctgttgaaa 180 181 cacagggaag aaattggtaa tcgatacatc gagatatttc caagcagaag gaatgaagtt 240 241 cga 243 Residues: 81 aa Molecule Weight: 9537.39 Dalton Number of Met residues: 2 Percentage of Met residues: 2.47 % Number of Cys residues: 1 Percentage of Cys residues: 1.23 %

>WS.B3220B|401:480 tid:429305 alias: stage:proposed target fragment|401:480 CP Pir/Fasta HFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKD RSHVHHRYIELFLNSCPKGK CDS cDNA 240 bp 1 cattttgtcc acatgagagg attacctttc caagccaatg cccaagacat tataaacttt 60 61 tttgctccac tcaagcctgt tagaatcacc atggaataca gctccagtgg gaaggccact 120 121 ggagaagctg atgtgcactt tgagacccat gaggatgctg ttgcagcgat gctcaaggat 180 181 cggtcccacg ttcatcatag gtatattgaa ctgttcctga attcatgtcc aaaaggaaaa 240 Residues: 80 aa Molecule Weight: 9091.91 Dalton Number of Met residues: 3 Percentage of Met residues: 3.75 % Number of Cys residues: 1 Percentage of Cys residues: 1.25 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu