LOADING...
   BC043071;BC043071
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC043071    Target Constructs

Accession: BC043071
Local acc: WT4514D.U2AF2
Description: BC043071 Mus musculus U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, mRNA (cDNA clone MGC:57976 IMAGE:6403830), complete cds, coding region:146-1561
Organism: MUS MUSCULUS
Residues: 471 aa
Constructs: 26
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>WT4514D.U2AF2|368:471 tid:422736 alias: stage:pdb deposition(pdb id:3V4M) fragment|368:471 CP Pir/Fasta
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGK
IFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
CDS  cDNA 312 bp
   1 ggtcacccaa ctgaggtcct gtgcctcatg aacatggtgc tgcctgagga gctgctggac    60
  61 gatgaggagt atgaggagat tgtagaggac gtacgagacg agtgcagcaa gtatgggttg   120
 121 gtcaaatcca ttgaaattcc ccgccccgtg gacggcgtcg aggtgcctgg ctgtggaaag   180
 181 atcttcgtgg agttcacctc tgtgtttgac tgccagaaag ccatgcaggg tctaaccggt   240
 241 cgcaagttcg ccaacagagt ggtggtcaca aaatactgtg accctgattc ttaccaccgt   300
 301 cgggacttct gg   312

Residues: 104 aa
Molecule Weight: 11962.03 Dalton
Number of Met residues: 3
Percentage of Met residues: 2.88 %
Number of Cys residues: 5
Percentage of Cys residues: 4.81 %

>WT4514D.U2AF2|1:471 tid:422734 alias: stage:crystal hit Full|1:471 CP Pir/Fasta MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLM SSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV EVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW CDS cDNA 1413 bp 1 atgtcggact tcgacgagtt cgagcggcag ctcaacgaga ataaacaaga gcgggacaag 60 61 gagaatcggc acaggaagcg tagtcacagt cgctctcgaa gccgagatcg aaagcgcagg 120 121 agcaggagcc gagatcggcg caaccgggac cagcgcagtg cctctcggga taggagacga 180 181 cgaagcaaac ctttgaccag aggcgctaaa gaggagcacg gtggattgat tcgttctccc 240 241 cgccatgaga agaagaagaa ggtgcgtaaa tactgggacg tgccaccgcc tggctttgag 300 301 cacatcaccc caatgcagta caaggccatg caagctgcgg gtcagattcc agccactgcc 360 361 cttctcccga ccatgactcc tgatggtctg gctgtgaccc caacgccagt gcctgtggtt 420 421 gggagccaga tgaccagaca ggccagacgt ctctacgtgg gcaacatccc ttttggcatt 480 481 actgaggagg ctatgatgga cttcttcaac gcccagatgc gcttgggagg gttgactcag 540 541 gcccctggca acccagtctt ggctgtgcag ataaatcaag acaagaattt tgcctttttg 600 601 gagttccggt cagtggatga gacgacccag gccatggcat ttgatggcat catcttccag 660 661 ggccagtcat tgaagattcg aaggcctcat gactatcagc cattgcctgg catgtcagag 720 721 aacccctctg tttatgtgcc tggagttgta tccactgtag tcccagattc tgcccacaag 780 781 ctgttcatcg ggggtttgcc caattaccta aatgatgacc aggtaaaaga gctgctgaca 840 841 tcctttgggc ctctcaaggc cttcaacttg gttaaggata gtgccacagg gctctccaag 900 901 ggctatgcct tctgtgagta cgtggacatc aacgtcacag atcaggccat tgcggggctg 960 961 aatgggatgc agctagggga caagaagctg cttgtccaga gggcgagtgt gggagccaag 1020 1021 aatgccacgc tgagcaccat caatcagaca cctgtgaccc ttcaagtgcc cggcctgatg 1080 1081 agctctcagg tgcagatggg cggtcaccca actgaggtcc tgtgcctcat gaacatggtg 1140 1141 ctgcctgagg agctgctgga cgatgaggag tatgaggaga ttgtagagga cgtacgagac 1200 1201 gagtgcagca agtatgggtt ggtcaaatcc attgaaattc cccgccccgt ggacggcgtc 1260 1261 gaggtgcctg gctgtggaaa gatcttcgtg gagttcacct ctgtgtttga ctgccagaaa 1320 1321 gccatgcagg gtctaaccgg tcgcaagttc gccaacagag tggtggtcac aaaatactgt 1380 1381 gaccctgatt cttaccaccg tcgggacttc tgg 1413 Residues: 471 aa Molecule Weight: 53117.85 Dalton Number of Met residues: 16 Percentage of Met residues: 3.40 % Number of Cys residues: 6 Percentage of Cys residues: 1.27 %

>WT4514D.U2AF2|148:336 tid:422735 alias: stage:crystallization fragment|148:336 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLP NYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGD KKLLVQRAS CDS cDNA 567 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccagtcatt gaagattcga 240 241 aggcctcatg actatcagcc attgcctggc atgtcagaga acccctctgt ttatgtgcct 300 301 ggagttgtat ccactgtagt cccagattct gcccacaagc tgttcatcgg gggtttgccc 360 361 aattacctaa atgatgacca ggtaaaagag ctgctgacat cctttgggcc tctcaaggcc 420 421 ttcaacttgg ttaaggatag tgccacaggg ctctccaagg gctatgcctt ctgtgagtac 480 481 gtggacatca acgtcacaga tcaggccatt gcggggctga atgggatgca gctaggggac 540 541 aagaagctgc ttgtccagag ggcgagt 567 Residues: 189 aa Molecule Weight: 20690.57 Dalton Number of Met residues: 6 Percentage of Met residues: 3.17 % Number of Cys residues: 1 Percentage of Cys residues: 0.53 %

>WT4514D.U2AF2|1:141 tid:429861 alias: stage:protein purification fragment|1:141 CP Pir/Fasta MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA LLPTMTPDGLAVTPTPVPVVG CDS cDNA 423 bp 1 atgtcggact tcgacgagtt cgagcggcag ctcaacgaga ataaacaaga gcgggacaag 60 61 gagaatcggc acaggaagcg tagtcacagt cgctctcgaa gccgagatcg aaagcgcagg 120 121 agcaggagcc gagatcggcg caaccgggac cagcgcagtg cctctcggga taggagacga 180 181 cgaagcaaac ctttgaccag aggcgctaaa gaggagcacg gtggattgat tcgttctccc 240 241 cgccatgaga agaagaagaa ggtgcgtaaa tactgggacg tgccaccgcc tggctttgag 300 301 cacatcaccc caatgcagta caaggccatg caagctgcgg gtcagattcc agccactgcc 360 361 cttctcccga ccatgactcc tgatggtctg gctgtgaccc caacgccagt gcctgtggtt 420 421 ggg 423 Residues: 141 aa Molecule Weight: 16615.98 Dalton Number of Met residues: 4 Percentage of Met residues: 2.84 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|88:112 tid:430624 alias: stage:protein purification fragment|88:112 CP Pir/Fasta VRKYWDVPPPGFEHITPMQYKAMQA CDS cDNA 75 bp 1 gtgcgtaaat actgggacgt gccaccgcct ggctttgagc acatcacccc aatgcagtac 60 61 aaggccatgc aagct 75 Residues: 25 aa Molecule Weight: 2990.37 Dalton Number of Met residues: 2 Percentage of Met residues: 8.00 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|148:229 tid:430585 alias: stage:protein purification fragment|148:229 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQSLKIRRP CDS cDNA 246 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccagtcatt gaagattcga 240 241 aggcct 246 Residues: 82 aa Molecule Weight: 9210.11 Dalton Number of Met residues: 4 Percentage of Met residues: 4.88 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|148:342 tid:430584 alias: stage:protein purification fragment|148:342 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLP NYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGD KKLLVQRASVGAKNA CDS cDNA 585 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccagtcatt gaagattcga 240 241 aggcctcatg actatcagcc attgcctggc atgtcagaga acccctctgt ttatgtgcct 300 301 ggagttgtat ccactgtagt cccagattct gcccacaagc tgttcatcgg gggtttgccc 360 361 aattacctaa atgatgacca ggtaaaagag ctgctgacat cctttgggcc tctcaaggcc 420 421 ttcaacttgg ttaaggatag tgccacaggg ctctccaagg gctatgcctt ctgtgagtac 480 481 gtggacatca acgtcacaga tcaggccatt gcggggctga atgggatgca gctaggggac 540 541 aagaagctgc ttgtccagag ggcgagtgtg ggagccaaga atgcc 585 Residues: 195 aa Molecule Weight: 21231.16 Dalton Number of Met residues: 6 Percentage of Met residues: 3.08 % Number of Cys residues: 1 Percentage of Cys residues: 0.51 %

>WT4514D.U2AF2|258:342 tid:430587 alias: stage:protein purification fragment|258:342 CP Pir/Fasta AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI AGLNGMQLGDKKLLVQRASVGAKNA CDS cDNA 255 bp 1 gcccacaagc tgttcatcgg gggtttgccc aattacctaa atgatgacca ggtaaaagag 60 61 ctgctgacat cctttgggcc tctcaaggcc ttcaacttgg ttaaggatag tgccacaggg 120 121 ctctccaagg gctatgcctt ctgtgagtac gtggacatca acgtcacaga tcaggccatt 180 181 gcggggctga atgggatgca gctaggggac aagaagctgc ttgtccagag ggcgagtgtg 240 241 ggagccaaga atgcc 255 Residues: 85 aa Molecule Weight: 9085.94 Dalton Number of Met residues: 1 Percentage of Met residues: 1.18 % Number of Cys residues: 1 Percentage of Cys residues: 1.18 %

>WT4514D.U2AF2|342:471 tid:430589 alias: stage:protein purification fragment|342:471 CP Pir/Fasta ATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDE CSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCD PDSYHRRDFW CDS cDNA 390 bp 1 gccacgctga gcaccatcaa tcagacacct gtgacccttc aagtgcccgg cctgatgagc 60 61 tctcaggtgc agatgggcgg tcacccaact gaggtcctgt gcctcatgaa catggtgctg 120 121 cctgaggagc tgctggacga tgaggagtat gaggagattg tagaggacgt acgagacgag 180 181 tgcagcaagt atgggttggt caaatccatt gaaattcccc gccccgtgga cggcgtcgag 240 241 gtgcctggct gtggaaagat cttcgtggag ttcacctctg tgtttgactg ccagaaagcc 300 301 atgcagggtc taaccggtcg caagttcgcc aacagagtgg tggtcacaaa atactgtgac 360 361 cctgattctt accaccgtcg ggacttctgg 390 Residues: 130 aa Molecule Weight: 14646.02 Dalton Number of Met residues: 5 Percentage of Met residues: 3.85 % Number of Cys residues: 5 Percentage of Cys residues: 3.85 %

>WT4514D.U2AF2|1:148 tid:430586 alias: stage:plasmid purification fragment|1:148 CP Pir/Fasta MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA LLPTMTPDGLAVTPTPVPVVGSQMTRQA CDS cDNA 444 bp 1 atgtcggact tcgacgagtt cgagcggcag ctcaacgaga ataaacaaga gcgggacaag 60 61 gagaatcggc acaggaagcg tagtcacagt cgctctcgaa gccgagatcg aaagcgcagg 120 121 agcaggagcc gagatcggcg caaccgggac cagcgcagtg cctctcggga taggagacga 180 181 cgaagcaaac ctttgaccag aggcgctaaa gaggagcacg gtggattgat tcgttctccc 240 241 cgccatgaga agaagaagaa ggtgcgtaaa tactgggacg tgccaccgcc tggctttgag 300 301 cacatcaccc caatgcagta caaggccatg caagctgcgg gtcagattcc agccactgcc 360 361 cttctcccga ccatgactcc tgatggtctg gctgtgaccc caacgccagt gcctgtggtt 420 421 gggagccaga tgaccagaca ggcc 444 Residues: 148 aa Molecule Weight: 17418.85 Dalton Number of Met residues: 5 Percentage of Met residues: 3.38 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|79:142 tid:429176 alias: stage:plasmid purification fragment|79:142 CP Pir/Fasta SPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVP VVGS CDS cDNA 192 bp 1 tctccccgcc atgagaagaa gaagaaggtg cgtaaatact gggacgtgcc accgcctggc 60 61 tttgagcaca tcaccccaat gcagtacaag gccatgcaag ctgcgggtca gattccagcc 120 121 actgcccttc tcccgaccat gactcctgat ggtctggctg tgaccccaac gccagtgcct 180 181 gtggttggga gc 192 Residues: 64 aa Molecule Weight: 6963.84 Dalton Number of Met residues: 3 Percentage of Met residues: 4.69 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|85:94 tid:429854 alias: stage:plasmid purification fragment|85:94 CP Pir/Fasta KKKVRKYWDV CDS cDNA 30 bp 1 aagaagaagg tgcgtaaata ctgggacgtg 30 Residues: 10 aa Molecule Weight: 1349.60 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|85:111 tid:429178 alias: stage:plasmid purification fragment|85:111 CP Pir/Fasta KKKVRKYWDVPPPGFEHITPMQYKAMQ CDS cDNA 81 bp 1 aagaagaagg tgcgtaaata ctgggacgtg ccaccgcctg gctttgagca catcacccca 60 61 atgcagtaca aggccatgca a 81 Residues: 27 aa Molecule Weight: 3303.81 Dalton Number of Met residues: 2 Percentage of Met residues: 7.41 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|85:112 tid:425495 alias: stage:plasmid purification fragment|85:112 CP Pir/Fasta KKKVRKYWDVPPPGFEHITPMQYKAMQA CDS cDNA 84 bp 1 aagaagaagg tgcgtaaata ctgggacgtg ccaccgcctg gctttgagca catcacccca 60 61 atgcagtaca aggccatgca agct 84 Residues: 28 aa Molecule Weight: 3374.88 Dalton Number of Met residues: 2 Percentage of Met residues: 7.14 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|90:112 tid:429775 alias: stage:plasmid purification fragment|90:112 CP Pir/Fasta KYWDVPPPGFEHITPMQYKAMQA CDS cDNA 69 bp 1 aaatactggg acgtgccacc gcctggcttt gagcacatca ccccaatgca gtacaaggcc 60 61 atgcaagct 69 Residues: 23 aa Molecule Weight: 2735.06 Dalton Number of Met residues: 2 Percentage of Met residues: 8.70 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|258:375 tid:430590 alias: stage:plasmid purification fragment|258:375 CP Pir/Fasta AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI AGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLC CDS cDNA 354 bp 1 gcccacaagc tgttcatcgg gggtttgccc aattacctaa atgatgacca ggtaaaagag 60 61 ctgctgacat cctttgggcc tctcaaggcc ttcaacttgg ttaaggatag tgccacaggg 120 121 ctctccaagg gctatgcctt ctgtgagtac gtggacatca acgtcacaga tcaggccatt 180 181 gcggggctga atgggatgca gctaggggac aagaagctgc ttgtccagag ggcgagtgtg 240 241 ggagccaaga atgccacgct gagcaccatc aatcagacac ctgtgaccct tcaagtgccc 300 301 ggcctgatga gctctcaggt gcagatgggc ggtcacccaa ctgaggtcct gtgc 354 Residues: 118 aa Molecule Weight: 12535.78 Dalton Number of Met residues: 3 Percentage of Met residues: 2.54 % Number of Cys residues: 2 Percentage of Cys residues: 1.69 %

>WT4514D.U2AF2|375:471 tid:430588 alias: stage:plasmid purification fragment|375:471 CP Pir/Fasta CLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTS VFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW CDS cDNA 291 bp 1 tgcctcatga acatggtgct gcctgaggag ctgctggacg atgaggagta tgaggagatt 60 61 gtagaggacg tacgagacga gtgcagcaag tatgggttgg tcaaatccat tgaaattccc 120 121 cgccccgtgg acggcgtcga ggtgcctggc tgtggaaaga tcttcgtgga gttcacctct 180 181 gtgtttgact gccagaaagc catgcagggt ctaaccggtc gcaagttcgc caacagagtg 240 241 gtggtcacaa aatactgtga ccctgattct taccaccgtc gggacttctg g 291 Residues: 97 aa Molecule Weight: 11228.24 Dalton Number of Met residues: 3 Percentage of Met residues: 3.09 % Number of Cys residues: 5 Percentage of Cys residues: 5.15 %

>WT4514D.U2AF2|50:471 tid:425501 alias: stage:proposed target fragment|50:471 CP Pir/Fasta DQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKA MQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFF NAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRP HDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFN LVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQ TPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVK SIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRD FW CDS cDNA 1266 bp 1 gaccagcgca gtgcctctcg ggataggaga cgacgaagca aacctttgac cagaggcgct 60 61 aaagaggagc acggtggatt gattcgttct ccccgccatg agaagaagaa gaaggtgcgt 120 121 aaatactggg acgtgccacc gcctggcttt gagcacatca ccccaatgca gtacaaggcc 180 181 atgcaagctg cgggtcagat tccagccact gcccttctcc cgaccatgac tcctgatggt 240 241 ctggctgtga ccccaacgcc agtgcctgtg gttgggagcc agatgaccag acaggccaga 300 301 cgtctctacg tgggcaacat cccttttggc attactgagg aggctatgat ggacttcttc 360 361 aacgcccaga tgcgcttggg agggttgact caggcccctg gcaacccagt cttggctgtg 420 421 cagataaatc aagacaagaa ttttgccttt ttggagttcc ggtcagtgga tgagacgacc 480 481 caggccatgg catttgatgg catcatcttc cagggccagt cattgaagat tcgaaggcct 540 541 catgactatc agccattgcc tggcatgtca gagaacccct ctgtttatgt gcctggagtt 600 601 gtatccactg tagtcccaga ttctgcccac aagctgttca tcgggggttt gcccaattac 660 661 ctaaatgatg accaggtaaa agagctgctg acatcctttg ggcctctcaa ggccttcaac 720 721 ttggttaagg atagtgccac agggctctcc aagggctatg ccttctgtga gtacgtggac 780 781 atcaacgtca cagatcaggc cattgcgggg ctgaatggga tgcagctagg ggacaagaag 840 841 ctgcttgtcc agagggcgag tgtgggagcc aagaatgcca cgctgagcac catcaatcag 900 901 acacctgtga cccttcaagt gcccggcctg atgagctctc aggtgcagat gggcggtcac 960 961 ccaactgagg tcctgtgcct catgaacatg gtgctgcctg aggagctgct ggacgatgag 1020 1021 gagtatgagg agattgtaga ggacgtacga gacgagtgca gcaagtatgg gttggtcaaa 1080 1081 tccattgaaa ttccccgccc cgtggacggc gtcgaggtgc ctggctgtgg aaagatcttc 1140 1141 gtggagttca cctctgtgtt tgactgccag aaagccatgc agggtctaac cggtcgcaag 1200 1201 ttcgccaaca gagtggtggt cacaaaatac tgtgaccctg attcttacca ccgtcgggac 1260 1261 ttctgg 1266 Residues: 422 aa Molecule Weight: 46750.23 Dalton Number of Met residues: 15 Percentage of Met residues: 3.55 % Number of Cys residues: 6 Percentage of Cys residues: 1.42 %

>WT4514D.U2AF2|85:94 tid:429846 alias: stage:proposed target fragment|85:94 CP Pir/Fasta KKKVRKYWDV CDS cDNA 30 bp 1 aagaagaagg tgcgtaaata ctgggacgtg 30 Residues: 10 aa Molecule Weight: 1349.60 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|90:111 tid:429774 alias: stage:proposed target fragment|90:111 CP Pir/Fasta KYWDVPPPGFEHITPMQYKAMQ CDS cDNA 66 bp 1 aaatactggg acgtgccacc gcctggcttt gagcacatca ccccaatgca gtacaaggcc 60 61 atgcaa 66 Residues: 22 aa Molecule Weight: 2663.99 Dalton Number of Met residues: 2 Percentage of Met residues: 9.09 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|130:471 tid:425502 alias: stage:proposed target fragment|130:471 CP Pir/Fasta LAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAV QINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGV VSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVD INVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGH PTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIF VEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW CDS cDNA 1026 bp 1 ctggctgtga ccccaacgcc agtgcctgtg gttgggagcc agatgaccag acaggccaga 60 61 cgtctctacg tgggcaacat cccttttggc attactgagg aggctatgat ggacttcttc 120 121 aacgcccaga tgcgcttggg agggttgact caggcccctg gcaacccagt cttggctgtg 180 181 cagataaatc aagacaagaa ttttgccttt ttggagttcc ggtcagtgga tgagacgacc 240 241 caggccatgg catttgatgg catcatcttc cagggccagt cattgaagat tcgaaggcct 300 301 catgactatc agccattgcc tggcatgtca gagaacccct ctgtttatgt gcctggagtt 360 361 gtatccactg tagtcccaga ttctgcccac aagctgttca tcgggggttt gcccaattac 420 421 ctaaatgatg accaggtaaa agagctgctg acatcctttg ggcctctcaa ggccttcaac 480 481 ttggttaagg atagtgccac agggctctcc aagggctatg ccttctgtga gtacgtggac 540 541 atcaacgtca cagatcaggc cattgcgggg ctgaatggga tgcagctagg ggacaagaag 600 601 ctgcttgtcc agagggcgag tgtgggagcc aagaatgcca cgctgagcac catcaatcag 660 661 acacctgtga cccttcaagt gcccggcctg atgagctctc aggtgcagat gggcggtcac 720 721 ccaactgagg tcctgtgcct catgaacatg gtgctgcctg aggagctgct ggacgatgag 780 781 gagtatgagg agattgtaga ggacgtacga gacgagtgca gcaagtatgg gttggtcaaa 840 841 tccattgaaa ttccccgccc cgtggacggc gtcgaggtgc ctggctgtgg aaagatcttc 900 901 gtggagttca cctctgtgtt tgactgccag aaagccatgc agggtctaac cggtcgcaag 960 961 ttcgccaaca gagtggtggt cacaaaatac tgtgaccctg attcttacca ccgtcgggac 1020 1021 ttctgg 1026 Residues: 342 aa Molecule Weight: 37651.21 Dalton Number of Met residues: 12 Percentage of Met residues: 3.51 % Number of Cys residues: 6 Percentage of Cys residues: 1.75 %

>WT4514D.U2AF2|148:222 tid:425496 alias: stage:proposed target fragment|148:222 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQ CDS cDNA 225 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccag 225 Residues: 75 aa Molecule Weight: 8359.10 Dalton Number of Met residues: 4 Percentage of Met residues: 5.33 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WT4514D.U2AF2|148:341 tid:425498 alias: stage:proposed target fragment|148:341 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLP NYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGD KKLLVQRASVGAKN CDS cDNA 582 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccagtcatt gaagattcga 240 241 aggcctcatg actatcagcc attgcctggc atgtcagaga acccctctgt ttatgtgcct 300 301 ggagttgtat ccactgtagt cccagattct gcccacaagc tgttcatcgg gggtttgccc 360 361 aattacctaa atgatgacca ggtaaaagag ctgctgacat cctttgggcc tctcaaggcc 420 421 ttcaacttgg ttaaggatag tgccacaggg ctctccaagg gctatgcctt ctgtgagtac 480 481 gtggacatca acgtcacaga tcaggccatt gcggggctga atgggatgca gctaggggac 540 541 aagaagctgc ttgtccagag ggcgagtgtg ggagccaaga at 582 Residues: 194 aa Molecule Weight: 21160.09 Dalton Number of Met residues: 6 Percentage of Met residues: 3.09 % Number of Cys residues: 1 Percentage of Cys residues: 0.52 %

>WT4514D.U2AF2|148:471 tid:425500 alias: stage:proposed target fragment|148:471 CP Pir/Fasta ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDE TTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLP NYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGD KKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLD DEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTG RKFANRVVVTKYCDPDSYHRRDFW CDS cDNA 972 bp 1 gccagacgtc tctacgtggg caacatccct tttggcatta ctgaggaggc tatgatggac 60 61 ttcttcaacg cccagatgcg cttgggaggg ttgactcagg cccctggcaa cccagtcttg 120 121 gctgtgcaga taaatcaaga caagaatttt gcctttttgg agttccggtc agtggatgag 180 181 acgacccagg ccatggcatt tgatggcatc atcttccagg gccagtcatt gaagattcga 240 241 aggcctcatg actatcagcc attgcctggc atgtcagaga acccctctgt ttatgtgcct 300 301 ggagttgtat ccactgtagt cccagattct gcccacaagc tgttcatcgg gggtttgccc 360 361 aattacctaa atgatgacca ggtaaaagag ctgctgacat cctttgggcc tctcaaggcc 420 421 ttcaacttgg ttaaggatag tgccacaggg ctctccaagg gctatgcctt ctgtgagtac 480 481 gtggacatca acgtcacaga tcaggccatt gcggggctga atgggatgca gctaggggac 540 541 aagaagctgc ttgtccagag ggcgagtgtg ggagccaaga atgccacgct gagcaccatc 600 601 aatcagacac ctgtgaccct tcaagtgccc ggcctgatga gctctcaggt gcagatgggc 660 661 ggtcacccaa ctgaggtcct gtgcctcatg aacatggtgc tgcctgagga gctgctggac 720 721 gatgaggagt atgaggagat tgtagaggac gtacgagacg agtgcagcaa gtatgggttg 780 781 gtcaaatcca ttgaaattcc ccgccccgtg gacggcgtcg aggtgcctgg ctgtggaaag 840 841 atcttcgtgg agttcacctc tgtgtttgac tgccagaaag ccatgcaggg tctaaccggt 900 901 cgcaagttcg ccaacagagt ggtggtcaca aaatactgtg accctgattc ttaccaccgt 960 961 cgggacttct gg 972 Residues: 324 aa Molecule Weight: 35788.09 Dalton Number of Met residues: 11 Percentage of Met residues: 3.40 % Number of Cys residues: 6 Percentage of Cys residues: 1.85 %

>WT4514D.U2AF2|259:341 tid:425497 alias: stage:proposed target fragment|259:341 CP Pir/Fasta HKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIA GLNGMQLGDKKLLVQRASVGAKN CDS cDNA 249 bp 1 cacaagctgt tcatcggggg tttgcccaat tacctaaatg atgaccaggt aaaagagctg 60 61 ctgacatcct ttgggcctct caaggccttc aacttggtta aggatagtgc cacagggctc 120 121 tccaagggct atgccttctg tgagtacgtg gacatcaacg tcacagatca ggccattgcg 180 181 gggctgaatg ggatgcagct aggggacaag aagctgcttg tccagagggc gagtgtggga 240 241 gccaagaat 249 Residues: 83 aa Molecule Weight: 8943.80 Dalton Number of Met residues: 1 Percentage of Met residues: 1.20 % Number of Cys residues: 1 Percentage of Cys residues: 1.20 %

>WT4514D.U2AF2|259:471 tid:425499 alias: stage:proposed target fragment|259:471 CP Pir/Fasta HKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIA GLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMN MVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDC QKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW CDS cDNA 639 bp 1 cacaagctgt tcatcggggg tttgcccaat tacctaaatg atgaccaggt aaaagagctg 60 61 ctgacatcct ttgggcctct caaggccttc aacttggtta aggatagtgc cacagggctc 120 121 tccaagggct atgccttctg tgagtacgtg gacatcaacg tcacagatca ggccattgcg 180 181 gggctgaatg ggatgcagct aggggacaag aagctgcttg tccagagggc gagtgtggga 240 241 gccaagaatg ccacgctgag caccatcaat cagacacctg tgacccttca agtgcccggc 300 301 ctgatgagct ctcaggtgca gatgggcggt cacccaactg aggtcctgtg cctcatgaac 360 361 atggtgctgc ctgaggagct gctggacgat gaggagtatg aggagattgt agaggacgta 420 421 cgagacgagt gcagcaagta tgggttggtc aaatccattg aaattccccg ccccgtggac 480 481 ggcgtcgagg tgcctggctg tggaaagatc ttcgtggagt tcacctctgt gtttgactgc 540 541 cagaaagcca tgcagggtct aaccggtcgc aagttcgcca acagagtggt ggtcacaaaa 600 601 tactgtgacc ctgattctta ccaccgtcgg gacttctgg 639 Residues: 213 aa Molecule Weight: 23571.80 Dalton Number of Met residues: 6 Percentage of Met residues: 2.82 % Number of Cys residues: 6 Percentage of Cys residues: 2.82 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu