LOADING...
   BC030493;WS20613E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC030493    Target Constructs

Accession: BC030493
Local acc: WS20613E.RBM39
Description: BC030493 Mus musculus RNA binding motif protein 39, mRNA (cDNA clone MGC:40964 IMAGE:5400675), complete cds, coding region:452-1555
Organism: MUS MUSCULUS
Residues: 367 aa
Constructs: 19
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>WS20613E.RBM39|255:367 tid:421759 alias: stage:pdb deposition(pdb id:3S6E) fragment|255:367 CP Pir/Fasta
VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK
CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
CDS  cDNA 339 bp
   1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa    60
  61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat   120
 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag   180
 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct   240
 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat   300
 301 tctatgacag caacacaact actggttcca agtagacga   339

Residues: 113 aa
Molecule Weight: 12503.61 Dalton
Number of Met residues: 3
Percentage of Met residues: 2.65 %
Number of Cys residues: 3
Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|1:365 tid:424732 alias: stage:screening fragment|1:365 CP Pir/Fasta MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASS FLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRL SQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHI YVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ LLVPS CDS cDNA 1095 bp 1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga 60 61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca 120 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga 180 181 gttttaggag tgccaatcat agttcaggca tcacaggcag aaaaaaacag agctgctgca 240 241 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 300 301 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 360 361 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 420 421 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 480 481 gggagaccaa tgaaagttgg tcacgttact gaacgaactg atgcttcgag tgctagttca 540 541 tttttggaca gtgacgaact agaaaggact ggaattgact tgggaacaac tggacgtctt 600 601 cagttaatgg caagacttgc ggagggtacc ggtttgcaga ttccacctgc cgcacaacaa 660 661 gcattacaaa tgagtggctc tctggcattt ggtgctgtgg cagatttgca aacacgactt 720 721 tcccaacaga ccgaagcctc agctttagct gcagctgcgt ctgttcaacc tcttgcaaca 780 781 cagtgtttcc aactttctaa catgtttaat cctcaaacag aagaagaagt tggatgggat 840 841 acagagatta aagatgatgt cattgaagaa tgtaataaac atggaggagt cattcatatt 900 901 tatgttgata aaaattcagc tcagggcaat gtgtatgtga agtgcccatc tattgctgcg 960 961 gctattgctg ctgtcaatgc attgcatggc agatggtttg ctggtaaaat gataacagca 1020 1021 gcgtatgtac ctcttccaac ttaccacaac ctctttcctg attctatgac agcaacacaa 1080 1081 ctactggttc caagt 1095 Residues: 365 aa Molecule Weight: 39503.80 Dalton Number of Met residues: 13 Percentage of Met residues: 3.56 % Number of Cys residues: 4 Percentage of Cys residues: 1.10 %

>WS20613E.RBM39|1:185 tid:421729 alias: stage:protein purification fragment|1:185 CP Pir/Fasta MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASS FLDSD CDS cDNA 555 bp 1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga 60 61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca 120 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga 180 181 gttttaggag tgccaatcat agttcaggca tcacaggcag aaaaaaacag agctgctgca 240 241 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 300 301 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 360 361 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 420 421 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 480 481 gggagaccaa tgaaagttgg tcacgttact gaacgaactg atgcttcgag tgctagttca 540 541 tttttggaca gtgac 555 Residues: 185 aa Molecule Weight: 20324.08 Dalton Number of Met residues: 8 Percentage of Met residues: 4.32 % Number of Cys residues: 1 Percentage of Cys residues: 0.54 %

>WS20613E.RBM39|255:367 tid:430603 alias: stage:plasmid purification fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430604 alias: stage:plasmid purification fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430600 alias: stage:plasmid purification fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|1:67 tid:425452 alias: stage:proposed target fragment|1:67 CP Pir/Fasta MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR VLGVPII CDS cDNA 201 bp 1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga 60 61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca 120 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga 180 181 gttttaggag tgccaatcat a 201 Residues: 67 aa Molecule Weight: 7487.35 Dalton Number of Met residues: 2 Percentage of Met residues: 2.99 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>WS20613E.RBM39|1:174 tid:425454 alias: stage:proposed target fragment|1:174 CP Pir/Fasta MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTD CDS cDNA 522 bp 1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga 60 61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca 120 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga 180 181 gttttaggag tgccaatcat agttcaggca tcacaggcag aaaaaaacag agctgctgca 240 241 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 300 301 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 360 361 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 420 421 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 480 481 gggagaccaa tgaaagttgg tcacgttact gaacgaactg at 522 Residues: 174 aa Molecule Weight: 19256.11 Dalton Number of Met residues: 8 Percentage of Met residues: 4.60 % Number of Cys residues: 1 Percentage of Cys residues: 0.57 %

>WS20613E.RBM39|1:367 tid:421605 alias: stage:proposed target Full|1:367 CP Pir/Fasta MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASS FLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRL SQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHI YVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ LLVPSRR CDS cDNA 1101 bp 1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga 60 61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca 120 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga 180 181 gttttaggag tgccaatcat agttcaggca tcacaggcag aaaaaaacag agctgctgca 240 241 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 300 301 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 360 361 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 420 421 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 480 481 gggagaccaa tgaaagttgg tcacgttact gaacgaactg atgcttcgag tgctagttca 540 541 tttttggaca gtgacgaact agaaaggact ggaattgact tgggaacaac tggacgtctt 600 601 cagttaatgg caagacttgc ggagggtacc ggtttgcaga ttccacctgc cgcacaacaa 660 661 gcattacaaa tgagtggctc tctggcattt ggtgctgtgg cagatttgca aacacgactt 720 721 tcccaacaga ccgaagcctc agctttagct gcagctgcgt ctgttcaacc tcttgcaaca 780 781 cagtgtttcc aactttctaa catgtttaat cctcaaacag aagaagaagt tggatgggat 840 841 acagagatta aagatgatgt cattgaagaa tgtaataaac atggaggagt cattcatatt 900 901 tatgttgata aaaattcagc tcagggcaat gtgtatgtga agtgcccatc tattgctgcg 960 961 gctattgctg ctgtcaatgc attgcatggc agatggtttg ctggtaaaat gataacagca 1020 1021 gcgtatgtac ctcttccaac ttaccacaac ctctttcctg attctatgac agcaacacaa 1080 1081 ctactggttc caagtagacg a 1101 Residues: 367 aa Molecule Weight: 39816.16 Dalton Number of Met residues: 13 Percentage of Met residues: 3.54 % Number of Cys residues: 4 Percentage of Cys residues: 1.09 %

>WS20613E.RBM39|81:174 tid:425453 alias: stage:proposed target fragment|81:174 CP Pir/Fasta MANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFIT FSDSECAKKALEQLNGFELAGRPMKVGHVTERTD CDS cDNA 282 bp 1 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 60 61 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 120 121 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 180 181 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 240 241 gggagaccaa tgaaagttgg tcacgttact gaacgaactg at 282 Residues: 94 aa Molecule Weight: 10461.41 Dalton Number of Met residues: 6 Percentage of Met residues: 6.38 % Number of Cys residues: 1 Percentage of Cys residues: 1.06 %

>WS20613E.RBM39|81:367 tid:425455 alias: stage:proposed target fragment|81:367 CP Pir/Fasta MANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFIT FSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRL QLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRLSQQTEASALAAAASVQPLAT QCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAA AIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 861 bp 1 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta 60 61 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa 120 121 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca 180 181 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct 240 241 gggagaccaa tgaaagttgg tcacgttact gaacgaactg atgcttcgag tgctagttca 300 301 tttttggaca gtgacgaact agaaaggact ggaattgact tgggaacaac tggacgtctt 360 361 cagttaatgg caagacttgc ggagggtacc ggtttgcaga ttccacctgc cgcacaacaa 420 421 gcattacaaa tgagtggctc tctggcattt ggtgctgtgg cagatttgca aacacgactt 480 481 tcccaacaga ccgaagcctc agctttagct gcagctgcgt ctgttcaacc tcttgcaaca 540 541 cagtgtttcc aactttctaa catgtttaat cctcaaacag aagaagaagt tggatgggat 600 601 acagagatta aagatgatgt cattgaagaa tgtaataaac atggaggagt cattcatatt 660 661 tatgttgata aaaattcagc tcagggcaat gtgtatgtga agtgcccatc tattgctgcg 720 721 gctattgctg ctgtcaatgc attgcatggc agatggtttg ctggtaaaat gataacagca 780 781 gcgtatgtac ctcttccaac ttaccacaac ctctttcctg attctatgac agcaacacaa 840 841 ctactggttc caagtagacg a 861 Residues: 287 aa Molecule Weight: 31021.46 Dalton Number of Met residues: 11 Percentage of Met residues: 3.83 % Number of Cys residues: 4 Percentage of Cys residues: 1.39 %

>WS20613E.RBM39|255:367 tid:430601 alias: stage:proposed target fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430602 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430323 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430411 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430410 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430409 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430407 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %

>WS20613E.RBM39|255:367 tid:430408 alias: stage: fragment|255:367 CP Pir/Fasta VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR CDS cDNA 339 bp 1 gttcaacctc ttgcaacaca gtgtttccaa ctttctaaca tgtttaatcc tcaaacagaa 60 61 gaagaagttg gatgggatac agagattaaa gatgatgtca ttgaagaatg taataaacat 120 121 ggaggagtca ttcatattta tgttgataaa aattcagctc agggcaatgt gtatgtgaag 180 181 tgcccatcta ttgctgcggc tattgctgct gtcaatgcat tgcatggcag atggtttgct 240 241 ggtaaaatga taacagcagc gtatgtacct cttccaactt accacaacct ctttcctgat 300 301 tctatgacag caacacaact actggttcca agtagacga 339 Residues: 113 aa Molecule Weight: 12503.61 Dalton Number of Met residues: 3 Percentage of Met residues: 2.65 % Number of Cys residues: 3 Percentage of Cys residues: 2.65 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu