LOADING...
   BC013200;WT2001B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC013200    Target Constructs

Accession: BC013200
Local acc: WT2001B.LCK
Description: BC013200 Homo sapiens lymphocyte-specific protein tyrosine kinase, mRNA (cDNA clone MGC:17196 IMAGE:4341278), complete cds, coding region:101-1720
Organism: HOMO SAPIENS
Residues: 539 aa
Constructs: 3
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>WT2001B.LCK|53:226 tid:422603 alias: stage:pdb deposition(pdb id:4D8K) fragment|53:226 CP Pir/Fasta
GSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIP
FNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQ
NQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQT
CDS  cDNA 522 bp
   1 ggctccaatc cgccggcttc cccactgcaa gacaacctgg ttatcgctct gcacagctat    60
  61 gagccctctc acgacggaga tctgggcttt gagaaggggg aacagctccg catcctggag   120
 121 cagagcggcg agtggtggaa ggcgcagtcc ctgaccacgg gccaggaagg cttcatcccc   180
 181 ttcaattttg tggccaaagc gaacagcctg gagcccgaac cctggttctt caagaacctg   240
 241 agccgcaagg acgcggagcg gcagctcctg gcgcccggga acactcacgg ctccttcctc   300
 301 atccgggaga gcgagagcac cgcgggatcg ttttcactgt cggtccggga cttcgaccag   360
 361 aaccagggag aggtggtgaa acattacaag atccgtaatc tggacaacgg tggcttctac   420
 421 atctcccctc gaatcacttt tcccggcctg catgaactgg tccgccatta caccaatgct   480
 481 tcagatgggc tgtgcacacg gttgagccgc ccctgccaga cc   522

Residues: 174 aa
Molecule Weight: 19505.64 Dalton
Number of Met residues: 0
Percentage of Met residues: 0.00 %
Number of Cys residues: 2
Percentage of Cys residues: 1.15 %

>WT2001B.LCK|1:539 tid:422601 alias: stage:plasmid purification Full|1:539 CP Pir/Fasta MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL VRLYAVVTQEPIYIITEYMENDTLLDSQLEEKGLGASPWGNLGQQLLLLPTGSLVDFLKT PSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVI QNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP CDS cDNA 1617 bp 1 atgggctgtg gctgcagctc acacccggaa gatgactgga tggaaaacat cgatgtgtgt 60 61 gagaactgcc attatcccat agtcccactg gatggcaagg gcacgctgct catccgaaat 120 121 ggctctgagg tgcgggaccc actggttacc tacgaaggct ccaatccgcc ggcttcccca 180 181 ctgcaagaca acctggttat cgctctgcac agctatgagc cctctcacga cggagatctg 240 241 ggctttgaga agggggaaca gctccgcatc ctggagcaga gcggcgagtg gtggaaggcg 300 301 cagtccctga ccacgggcca ggaaggcttc atccccttca attttgtggc caaagcgaac 360 361 agcctggagc ccgaaccctg gttcttcaag aacctgagcc gcaaggacgc ggagcggcag 420 421 ctcctggcgc ccgggaacac tcacggctcc ttcctcatcc gggagagcga gagcaccgcg 480 481 ggatcgtttt cactgtcggt ccgggacttc gaccagaacc agggagaggt ggtgaaacat 540 541 tacaagatcc gtaatctgga caacggtggc ttctacatct cccctcgaat cacttttccc 600 601 ggcctgcatg aactggtccg ccattacacc aatgcttcag atgggctgtg cacacggttg 660 661 agccgcccct gccagaccca gaagccccag aagccgtggt gggaggacga gtgggaggtt 720 721 cccagggaga cgctgaagct ggtggagcgg ctgggggctg gacagttcgg ggaggtgtgg 780 781 atggggtact acaacgggca cacgaaggtg gcggtgaaga gcctgaagca gggcagcatg 840 841 tccccggacg ccttcctggc cgaggccaac ctcatgaagc agctgcaaca ccagcggctg 900 901 gttcggctct acgctgtggt cacccaggag cccatctaca tcatcactga atacatggag 960 961 aatgacacac ttctagactc ccagttggag gagaaaggtc tgggggcctc cccctggggc 1020 1021 aacttgggcc agcaactctt gcttctgccc acagggagtc tagtggattt tctcaagacc 1080 1081 ccttcaggca tcaagttgac catcaacaaa ctcctggaca tggcagccca aattgcagaa 1140 1141 ggcatggcat tcattgaaga gcggaattat attcatcgtg accttcgggc tgccaacatt 1200 1201 ctggtgtctg acaccctgag ctgcaagatt gcagactttg gcctagcacg cctcattgag 1260 1261 gacaacgagt acacagccag ggagggggcc aagtttccca ttaagtggac agcgccagaa 1320 1321 gccattaact acgggacatt caccatcaag tcagatgtgt ggtcttttgg gatcctgctg 1380 1381 acggaaattg tcacccacgg ccgcatccct tacccaggga tgaccaaccc ggaggtgatt 1440 1441 cagaacctgg agcgaggcta ccgcatggtg cgccctgaca actgtccaga ggagctgtac 1500 1501 caactcatga ggctgtgctg gaaggagcgc ccagaggacc ggcccacctt tgactacctg 1560 1561 cgcagtgtgc tggaggactt cttcacggcc acagagggcc agtaccagcc tcagcct 1617 Residues: 539 aa Molecule Weight: 61187.04 Dalton Number of Met residues: 11 Percentage of Met residues: 2.04 % Number of Cys residues: 9 Percentage of Cys residues: 1.67 %

>WT2001B.LCK|236:531 tid:422602 alias: stage:plasmid purification fragment|236:531 CP Pir/Fasta DEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQL QHQRLVRLYAVVTQEPIYIITEYMENDTLLDSQLEEKGLGASPWGNLGQQLLLLPTGSLV DFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGL ARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMT NPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTAT CDS cDNA 888 bp 1 gacgagtggg aggttcccag ggagacgctg aagctggtgg agcggctggg ggctggacag 60 61 ttcggggagg tgtggatggg gtactacaac gggcacacga aggtggcggt gaagagcctg 120 121 aagcagggca gcatgtcccc ggacgccttc ctggccgagg ccaacctcat gaagcagctg 180 181 caacaccagc ggctggttcg gctctacgct gtggtcaccc aggagcccat ctacatcatc 240 241 actgaataca tggagaatga cacacttcta gactcccagt tggaggagaa aggtctgggg 300 301 gcctccccct ggggcaactt gggccagcaa ctcttgcttc tgcccacagg gagtctagtg 360 361 gattttctca agaccccttc aggcatcaag ttgaccatca acaaactcct ggacatggca 420 421 gcccaaattg cagaaggcat ggcattcatt gaagagcgga attatattca tcgtgacctt 480 481 cgggctgcca acattctggt gtctgacacc ctgagctgca agattgcaga ctttggccta 540 541 gcacgcctca ttgaggacaa cgagtacaca gccagggagg gggccaagtt tcccattaag 600 601 tggacagcgc cagaagccat taactacggg acattcacca tcaagtcaga tgtgtggtct 660 661 tttgggatcc tgctgacgga aattgtcacc cacggccgca tcccttaccc agggatgacc 720 721 aacccggagg tgattcagaa cctggagcga ggctaccgca tggtgcgccc tgacaactgt 780 781 ccagaggagc tgtaccaact catgaggctg tgctggaagg agcgcccaga ggaccggccc 840 841 acctttgact acctgcgcag tgtgctggag gacttcttca cggccaca 888 Residues: 296 aa Molecule Weight: 33771.95 Dalton Number of Met residues: 9 Percentage of Met residues: 3.04 % Number of Cys residues: 3 Percentage of Cys residues: 1.01 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu