LOADING...
   BC011707;KN.B21268A.NRBF2
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011707    Target Constructs

Accession: BC011707
Local acc: KN.B21268A.NRBF2
Description: BC011707 Homo sapiens nuclear receptor binding factor 2, mRNA (cDNA clone MGC:19778 IMAGE:3687848), complete cds, coding region:99-962
Organism: HOMO SAPIENS
Residues: 287 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>KN.B21268A.NRBF2|4:86 tid:429611 alias: stage:pdb deposition(pdb id:4ZEY) fragment|4:86 CP Pir/Fasta
MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDS
HMKQLLLIQERWKRAQREERLKA
CDS  cDNA 249 bp
   1 atggaaggac ccctcaacct ggctcatcaa cagagcagac gagcagaccg tttattagct    60
  61 gcaggcaaat acgaagaggc tatttcttgt cacaaaaagg ctgcagcata tctttctgaa   120
 121 gccatgaagc tgacacagtc agagcaggct catctttcac tggaattgca aagggatagc   180
 181 catatgaaac agctcctcct catccaagag agatggaaaa gggcccagcg tgaagaaaga   240
 241 ttgaaagcc   249

Residues: 83 aa
Molecule Weight: 9638.57 Dalton
Number of Met residues: 3
Percentage of Met residues: 3.61 %
Number of Cys residues: 1
Percentage of Cys residues: 1.20 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu