LOADING...
   BC011564;RF20603A.DAX1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011564    Target Constructs

Accession: BC011564
Local acc: RF20603A.DAX1
Description: BC011564 Homo sapiens nuclear receptor subfamily 0, group B, member 1, mRNA (cDNA clone MGC:20161 IMAGE:4637694), complete cds, coding region:13-1425
Organism: HOMO SAPIENS
Residues: 470 aa
Constructs: 15
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>RF20603A.DAX1|1:50 tid:421397 alias: stage:protein purification fragment|1:50 CP Pir/Fasta
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG
CDS  cDNA 150 bp
   1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg    60
  61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc   120
 121 tgttcgtgcg gcgatgagcc cggggtgggc   150

Residues: 50 aa
Molecule Weight: 5424.81 Dalton
Number of Met residues: 3
Percentage of Met residues: 6.00 %
Number of Cys residues: 3
Percentage of Cys residues: 6.00 %

>RF20603A.DAX1|1:470 tid:421170 alias: stage:protein purification Full|1:470 CP Pir/Fasta MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI CDS cDNA 1410 bp 1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg 60 61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc 120 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg 180 181 gcgctcctgt accgctgctg cttttgcggt aaagaccacc cacggcaggg cagcatcctc 240 241 tacagcatgc tgacgagcgc aaagcaaacg tacgcggcac cgaaggcgcc cgaggcgacg 300 301 ctgggtccgt gctggggctg ttcgtgcggc tctgatcccg gggtgggcag agcggggctt 360 361 ccgggtgggc ggcccgtggc actcctgtac cgctgctgct tttgtggtga agaccacccg 420 421 cggcagggca gcatcctcta cagcttgctc actagctcaa agcaaacgca cgtggctccg 480 481 gcagcgcccg aggcacggcc agggggcgcg tggtgggacc gctcctactt cgcgcagagg 540 541 ccagggggta aagaggcgct accaggcggg cgggccacgg cgcttctgta ccgctgctgc 600 601 ttttgcggtg aagaccaccc gcagcagggc agcaccctct actgcgtgcc cacgagcaca 660 661 aatcaagcgc aggcggctcc ggaggagcgg ccgagggccc cctggtggga cacctcctct 720 721 ggtgcgctgc ggccggtggc gctcaagagt ccacaggtgg tctgcgaggc agcctcagcg 780 781 ggcctgttga agacgctgcg cttcgtcaag tacttgccct gcttccaggt gctgcccctg 840 841 gaccagcagc tggtgctggt gcgcaactgc tgggcgtccc tgctcatgct tgagctggcc 900 901 caggaccgct tgcagttcga gactgtggaa gtctcggagc ccagcatgct gcagaagatc 960 961 ctcaccacca ggcggcggga gaccgggggc aacgagccac tgcccgtgcc cacgctgcag 1020 1021 caccatttgg caccgccggc ggaggccagg aaggtgccct ccgcctccca ggtccaagcc 1080 1081 atcaagtgct ttctttccaa atgctggagt ctgaacatca gtaccaagga gtacgcctac 1140 1141 ctcaagggga ccgtgctctt taacccggac gtgccgggcc tgcagtgcgt gaagtacatt 1200 1201 cagggactcc agtggggaac tcagcaaata ctcagtgaac acaccaggat gacgcaccaa 1260 1261 gggccccatg acagattcat cgaacttaat agtacccttt tcctgctgag attcatcaat 1320 1321 gccaatgtca ttgctgaact gttcttcagg cccatcatcg gcacagtcag catggatgat 1380 1381 atgatgctgg aaatgctctg tacaaagata 1410 Residues: 470 aa Molecule Weight: 51714.84 Dalton Number of Met residues: 11 Percentage of Met residues: 2.34 % Number of Cys residues: 23 Percentage of Cys residues: 4.89 %

>RF20603A.DAX1|203:470 tid:421425 alias: stage:protein purification fragment|203:470 CP Pir/Fasta GEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQVVCEAASAGL LKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILT TRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTKEYAYLK GTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINAN VIAELFFRPIIGTVSMDDMMLEMLCTKI CDS cDNA 804 bp 1 ggtgaagacc acccgcagca gggcagcacc ctctactgcg tgcccacgag cacaaatcaa 60 61 gcgcaggcgg ctccggagga gcggccgagg gccccctggt gggacacctc ctctggtgcg 120 121 ctgcggccgg tggcgctcaa gagtccacag gtggtctgcg aggcagcctc agcgggcctg 180 181 ttgaagacgc tgcgcttcgt caagtacttg ccctgcttcc aggtgctgcc cctggaccag 240 241 cagctggtgc tggtgcgcaa ctgctgggcg tccctgctca tgcttgagct ggcccaggac 300 301 cgcttgcagt tcgagactgt ggaagtctcg gagcccagca tgctgcagaa gatcctcacc 360 361 accaggcggc gggagaccgg gggcaacgag ccactgcccg tgcccacgct gcagcaccat 420 421 ttggcaccgc cggcggaggc caggaaggtg ccctccgcct cccaggtcca agccatcaag 480 481 tgctttcttt ccaaatgctg gagtctgaac atcagtacca aggagtacgc ctacctcaag 540 541 gggaccgtgc tctttaaccc ggacgtgccg ggcctgcagt gcgtgaagta cattcaggga 600 601 ctccagtggg gaactcagca aatactcagt gaacacacca ggatgacgca ccaagggccc 660 661 catgacagat tcatcgaact taatagtacc cttttcctgc tgagattcat caatgccaat 720 721 gtcattgctg aactgttctt caggcccatc atcggcacag tcagcatgga tgatatgatg 780 781 ctggaaatgc tctgtacaaa gata 804 Residues: 268 aa Molecule Weight: 30127.38 Dalton Number of Met residues: 7 Percentage of Met residues: 2.61 % Number of Cys residues: 8 Percentage of Cys residues: 2.99 %

>RF20603A.DAX1|205:470 tid:421576 alias: stage:protein purification fragment|205:470 CP Pir/Fasta DHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLK TLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTR RRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGT VLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVI AELFFRPIIGTVSMDDMMLEMLCTKI CDS cDNA 798 bp 1 gaccacccgc agcagggcag caccctctac tgcgtgccca cgagcacaaa tcaagcgcag 60 61 gcggctccgg aggagcggcc gagggccccc tggtgggaca cctcctctgg tgcgctgcgg 120 121 ccggtggcgc tcaagagtcc acaggtggtc tgcgaggcag cctcagcggg cctgttgaag 180 181 acgctgcgct tcgtcaagta cttgccctgc ttccaggtgc tgcccctgga ccagcagctg 240 241 gtgctggtgc gcaactgctg ggcgtccctg ctcatgcttg agctggccca ggaccgcttg 300 301 cagttcgaga ctgtggaagt ctcggagccc agcatgctgc agaagatcct caccaccagg 360 361 cggcgggaga ccgggggcaa cgagccactg cccgtgccca cgctgcagca ccatttggca 420 421 ccgccggcgg aggccaggaa ggtgccctcc gcctcccagg tccaagccat caagtgcttt 480 481 ctttccaaat gctggagtct gaacatcagt accaaggagt acgcctacct caaggggacc 540 541 gtgctcttta acccggacgt gccgggcctg cagtgcgtga agtacattca gggactccag 600 601 tggggaactc agcaaatact cagtgaacac accaggatga cgcaccaagg gccccatgac 660 661 agattcatcg aacttaatag tacccttttc ctgctgagat tcatcaatgc caatgtcatt 720 721 gctgaactgt tcttcaggcc catcatcggc acagtcagca tggatgatat gatgctggaa 780 781 atgctctgta caaagata 798 Residues: 266 aa Molecule Weight: 29941.22 Dalton Number of Met residues: 7 Percentage of Met residues: 2.63 % Number of Cys residues: 8 Percentage of Cys residues: 3.01 %

>RF20603A.DAX1|1:67 tid:424744 alias: stage:plasmid purification fragment|1:67 CP Pir/Fasta MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV ALLYRCC CDS cDNA 201 bp 1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg 60 61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc 120 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg 180 181 gcgctcctgt accgctgctg c 201 Residues: 67 aa Molecule Weight: 7299.94 Dalton Number of Met residues: 3 Percentage of Met residues: 4.48 % Number of Cys residues: 5 Percentage of Cys residues: 7.46 %

>RF20603A.DAX1|1:133 tid:424745 alias: stage:plasmid purification fragment|1:133 CP Pir/Fasta MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL PGGRPVALLYRCC CDS cDNA 399 bp 1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg 60 61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc 120 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg 180 181 gcgctcctgt accgctgctg cttttgcggt aaagaccacc cacggcaggg cagcatcctc 240 241 tacagcatgc tgacgagcgc aaagcaaacg tacgcggcac cgaaggcgcc cgaggcgacg 300 301 ctgggtccgt gctggggctg ttcgtgcggc tctgatcccg gggtgggcag agcggggctt 360 361 ccgggtgggc ggcccgtggc actcctgtac cgctgctgc 399 Residues: 133 aa Molecule Weight: 14111.42 Dalton Number of Met residues: 4 Percentage of Met residues: 3.01 % Number of Cys residues: 11 Percentage of Cys residues: 8.27 %

>RF20603A.DAX1|1:200 tid:424746 alias: stage:plasmid purification fragment|1:200 CP Pir/Fasta MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR PGGKEALPGGRATALLYRCC CDS cDNA 600 bp 1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg 60 61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc 120 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg 180 181 gcgctcctgt accgctgctg cttttgcggt aaagaccacc cacggcaggg cagcatcctc 240 241 tacagcatgc tgacgagcgc aaagcaaacg tacgcggcac cgaaggcgcc cgaggcgacg 300 301 ctgggtccgt gctggggctg ttcgtgcggc tctgatcccg gggtgggcag agcggggctt 360 361 ccgggtgggc ggcccgtggc actcctgtac cgctgctgct tttgtggtga agaccacccg 420 421 cggcagggca gcatcctcta cagcttgctc actagctcaa agcaaacgca cgtggctccg 480 481 gcagcgcccg aggcacggcc agggggcgcg tggtgggacc gctcctactt cgcgcagagg 540 541 ccagggggta aagaggcgct accaggcggg cgggccacgg cgcttctgta ccgctgctgc 600 Residues: 200 aa Molecule Weight: 21355.18 Dalton Number of Met residues: 4 Percentage of Met residues: 2.00 % Number of Cys residues: 14 Percentage of Cys residues: 7.00 %

>RF20603A.DAX1|1:248 tid:424747 alias: stage:plasmid purification fragment|1:248 CP Pir/Fasta MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS GALRPVAL CDS cDNA 744 bp 1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg 60 61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc 120 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg 180 181 gcgctcctgt accgctgctg cttttgcggt aaagaccacc cacggcaggg cagcatcctc 240 241 tacagcatgc tgacgagcgc aaagcaaacg tacgcggcac cgaaggcgcc cgaggcgacg 300 301 ctgggtccgt gctggggctg ttcgtgcggc tctgatcccg gggtgggcag agcggggctt 360 361 ccgggtgggc ggcccgtggc actcctgtac cgctgctgct tttgtggtga agaccacccg 420 421 cggcagggca gcatcctcta cagcttgctc actagctcaa agcaaacgca cgtggctccg 480 481 gcagcgcccg aggcacggcc agggggcgcg tggtgggacc gctcctactt cgcgcagagg 540 541 ccagggggta aagaggcgct accaggcggg cgggccacgg cgcttctgta ccgctgctgc 600 601 ttttgcggtg aagaccaccc gcagcagggc agcaccctct actgcgtgcc cacgagcaca 660 661 aatcaagcgc aggcggctcc ggaggagcgg ccgagggccc cctggtggga cacctcctct 720 721 ggtgcgctgc ggccggtggc gctc 744 Residues: 248 aa Molecule Weight: 26564.61 Dalton Number of Met residues: 4 Percentage of Met residues: 1.61 % Number of Cys residues: 16 Percentage of Cys residues: 6.45 %

>RF20603A.DAX1|68:133 tid:424748 alias: stage:plasmid purification fragment|68:133 CP Pir/Fasta FCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVA LLYRCC CDS cDNA 198 bp 1 ttttgcggta aagaccaccc acggcagggc agcatcctct acagcatgct gacgagcgca 60 61 aagcaaacgt acgcggcacc gaaggcgccc gaggcgacgc tgggtccgtg ctggggctgt 120 121 tcgtgcggct ctgatcccgg ggtgggcaga gcggggcttc cgggtgggcg gcccgtggca 180 181 ctcctgtacc gctgctgc 198 Residues: 66 aa Molecule Weight: 6829.50 Dalton Number of Met residues: 1 Percentage of Met residues: 1.52 % Number of Cys residues: 6 Percentage of Cys residues: 9.09 %

>RF20603A.DAX1|68:200 tid:424749 alias: stage:plasmid purification fragment|68:200 CP Pir/Fasta FCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVA LLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEAL PGGRATALLYRCC CDS cDNA 399 bp 1 ttttgcggta aagaccaccc acggcagggc agcatcctct acagcatgct gacgagcgca 60 61 aagcaaacgt acgcggcacc gaaggcgccc gaggcgacgc tgggtccgtg ctggggctgt 120 121 tcgtgcggct ctgatcccgg ggtgggcaga gcggggcttc cgggtgggcg gcccgtggca 180 181 ctcctgtacc gctgctgctt ttgtggtgaa gaccacccgc ggcagggcag catcctctac 240 241 agcttgctca ctagctcaaa gcaaacgcac gtggctccgg cagcgcccga ggcacggcca 300 301 gggggcgcgt ggtgggaccg ctcctacttc gcgcagaggc cagggggtaa agaggcgcta 360 361 ccaggcgggc gggccacggc gcttctgtac cgctgctgc 399 Residues: 133 aa Molecule Weight: 14073.26 Dalton Number of Met residues: 1 Percentage of Met residues: 0.75 % Number of Cys residues: 9 Percentage of Cys residues: 6.77 %

>RF20603A.DAX1|134:200 tid:424750 alias: stage:plasmid purification fragment|134:200 CP Pir/Fasta FCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRAT ALLYRCC CDS cDNA 201 bp 1 ttttgtggtg aagaccaccc gcggcagggc agcatcctct acagcttgct cactagctca 60 61 aagcaaacgc acgtggctcc ggcagcgccc gaggcacggc cagggggcgc gtggtgggac 120 121 cgctcctact tcgcgcagag gccagggggt aaagaggcgc taccaggcgg gcgggccacg 180 181 gcgcttctgt accgctgctg c 201 Residues: 67 aa Molecule Weight: 7261.78 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 3 Percentage of Cys residues: 4.48 %

>RF20603A.DAX1|134:248 tid:424751 alias: stage:plasmid purification fragment|134:248 CP Pir/Fasta FCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRAT ALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVAL CDS cDNA 345 bp 1 ttttgtggtg aagaccaccc gcggcagggc agcatcctct acagcttgct cactagctca 60 61 aagcaaacgc acgtggctcc ggcagcgccc gaggcacggc cagggggcgc gtggtgggac 120 121 cgctcctact tcgcgcagag gccagggggt aaagaggcgc taccaggcgg gcgggccacg 180 181 gcgcttctgt accgctgctg cttttgcggt gaagaccacc cgcagcaggg cagcaccctc 240 241 tactgcgtgc ccacgagcac aaatcaagcg caggcggctc cggaggagcg gccgagggcc 300 301 ccctggtggg acacctcctc tggtgcgctg cggccggtgg cgctc 345 Residues: 115 aa Molecule Weight: 12471.21 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 5 Percentage of Cys residues: 4.35 %

>RF20603A.DAX1|136:203 tid:421396 alias: stage:plasmid purification fragment|136:203 CP Pir/Fasta GEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATAL LYRCCFCG CDS cDNA 204 bp 1 ggtgaagacc acccgcggca gggcagcatc ctctacagct tgctcactag ctcaaagcaa 60 61 acgcacgtgg ctccggcagc gcccgaggca cggccagggg gcgcgtggtg ggaccgctcc 120 121 tacttcgcgc agaggccagg gggtaaagag gcgctaccag gcgggcgggc cacggcgctt 180 181 ctgtaccgct gctgcttttg cggt 204 Residues: 68 aa Molecule Weight: 7318.83 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 3 Percentage of Cys residues: 4.41 %

>RF20603A.DAX1|140:154 tid:429925 alias: stage:plasmid purification fragment|140:154 CP Pir/Fasta PRQGSILYSLLTSSK CDS cDNA 45 bp 1 ccgcggcagg gcagcatcct ctacagcttg ctcactagct caaag 45 Residues: 15 aa Molecule Weight: 1649.81 Dalton Number of Met residues: 0 Percentage of Met residues: 0.00 % Number of Cys residues: 0 Percentage of Cys residues: 0.00 %

>RF20603A.DAX1|45:140 tid:421309 alias: stage:proposed target fragment|45:140 CP Pir/Fasta DEPGVGREGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPC WGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHP CDS cDNA 288 bp 1 gatgagcccg gggtgggcag agaggggctg ctgggcgggc ggaacgtggc gctcctgtac 60 61 cgctgctgct tttgcggtaa agaccaccca cggcagggca gcatcctcta cagcatgctg 120 121 acgagcgcaa agcaaacgta cgcggcaccg aaggcgcccg aggcgacgct gggtccgtgc 180 181 tggggctgtt cgtgcggctc tgatcccggg gtgggcagag cggggcttcc gggtgggcgg 240 241 cccgtggcac tcctgtaccg ctgctgcttt tgtggtgaag accacccg 288 Residues: 96 aa Molecule Weight: 10044.95 Dalton Number of Met residues: 1 Percentage of Met residues: 1.04 % Number of Cys residues: 9 Percentage of Cys residues: 9.38 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu