LOADING...
   AF124247;AF124247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
AF124247    Target Constructs

Accession: AF124247
Local acc: RC2754B.LRH_1
Description: AF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, complete cds, coding region:1-1623
Organism: HOMO SAPIENS
Residues: 541 aa
Constructs: 7
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>RC2754B.LRH_1|1:541 tid:423218 alias: stage:screening Full|1:541 CP Pir/Fasta
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
CDS  cDNA 1623 bp
   1 atgtcttcta attcagatac tggggattta caagagtctt taaagcacgg acttacacct    60
  61 attggtgctg ggcttccgga ccgacacgga tcccccatcc ccgcccgcgg tcgccttgtc   120
 121 atgctgccca aagtggagac ggaagccctg ggactggctc gatcgcatgg ggaacagggc   180
 181 cagatgccgg aaaacatgca agtgtctcaa tttaaaatgg tgaattactc ctatgatgaa   240
 241 gatctggaag agctttgtcc cgtgtgtgga gataaagtgt ctgggtacca ttatgggctc   300
 301 ctcacctgtg aaagctgcaa gggatttttt aagcgaacag tccaaaataa taaaaggtac   360
 361 acatgtatag aaaaccagaa ctgccaaatt gacaaaacac agagaaagcg ttgtccttac   420
 421 tgtcgttttc aaaaatgtct aagtgttgga atgaagctag aagctgtaag ggccgaccga   480
 481 atgcgtggag gaaggaataa gtttgggcca atgtacaaga gagacagggc cctgaagcaa   540
 541 cagaaaaaag ccctcatccg agccaatgga cttaagctag aagccatgtc tcaggtgatc   600
 601 caagctatgc cctctgacct gaccatttcc tctgcaattc aaaacatcca ctctgcctcc   660
 661 aaaggcctac ctctgaacca tgctgccttg cctcctacag actatgacag aagtcccttt   720
 721 gtaacatccc ccattagcat gacaatgccc cctcacggca gcctgcaagg ttaccaaaca   780
 781 tatggccact ttcctagccg ggccatcaag tctgagtacc cagaccccta taccagctca   840
 841 cccgagtcca taatgggcta ttcatatatg gatagttacc agacgagctc tccagcaagc   900
 901 atcccacatc tgatactgga acttttgaag tgtgagccag atgagcctca agtccaggct   960
 961 aaaatcatgg cctatttgca gcaagagcag gctaaccgaa gcaagcacga aaagctgagc  1020
1021 acctttgggc ttatgtgcaa aatggcagat caaactctct tctccattgt cgagtgggcc  1080
1081 aggagtagta tcttcttcag agaacttaag gttgatgacc aaatgaagct gcttcagaac  1140
1141 tgctggagtg agctcttaat cctcgaccac atttaccgac aagtggtaca tggaaaggaa  1200
1201 ggatccatct tcctggttac tgggcaacaa gtggactatt ccataatagc atcacaagcc  1260
1261 ggagccaccc tcaacaacct catgagtcat gcacaggagt tagtggcaaa acttcgttct  1320
1321 ctccagtttg atcaacgaga gttcgtatgt ctgaaattct tggtgctctt tagtttagat  1380
1381 gtcaaaaacc ttgaaaactt ccagctggta gaaggtgtcc aggaacaagt caatgccgcc  1440
1441 ctgctggact acacaatgtg taactacccg cagcagacag agaaatttgg acagctactt  1500
1501 cttcgactac ccgaaatccg ggccatcagt atgcaggctg aagaatacct ctactacaag  1560
1561 cacctgaacg gggatgtgcc ctataataac cttctcattg aaatgttgca tgccaaaaga  1620
1621 gca  1623

Residues: 541 aa
Molecule Weight: 61328.25 Dalton
Number of Met residues: 22
Percentage of Met residues: 4.07 %
Number of Cys residues: 14
Percentage of Cys residues: 2.59 %

>RC2754B.LRH_1|294:541 tid:423221 alias: stage:screening fragment|294:541 CP Pir/Fasta QTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTL FSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY SIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGV QEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLI EMLHAKRA CDS cDNA 744 bp 1 cagacgagct ctccagcaag catcccacat ctgatactgg aacttttgaa gtgtgagcca 60 61 gatgagcctc aagtccaggc taaaatcatg gcctatttgc agcaagagca ggctaaccga 120 121 agcaagcacg aaaagctgag cacctttggg cttatgtgca aaatggcaga tcaaactctc 180 181 ttctccattg tcgagtgggc caggagtagt atcttcttca gagaacttaa ggttgatgac 240 241 caaatgaagc tgcttcagaa ctgctggagt gagctcttaa tcctcgacca catttaccga 300 301 caagtggtac atggaaagga aggatccatc ttcctggtta ctgggcaaca agtggactat 360 361 tccataatag catcacaagc cggagccacc ctcaacaacc tcatgagtca tgcacaggag 420 421 ttagtggcaa aacttcgttc tctccagttt gatcaacgag agttcgtatg tctgaaattc 480 481 ttggtgctct ttagtttaga tgtcaaaaac cttgaaaact tccagctggt agaaggtgtc 540 541 caggaacaag tcaatgccgc cctgctggac tacacaatgt gtaactaccc gcagcagaca 600 601 gagaaatttg gacagctact tcttcgacta cccgaaatcc gggccatcag tatgcaggct 660 661 gaagaatacc tctactacaa gcacctgaac ggggatgtgc cctataataa ccttctcatt 720 721 gaaatgttgc atgccaaaag agca 744 Residues: 248 aa Molecule Weight: 28598.60 Dalton Number of Met residues: 8 Percentage of Met residues: 3.23 % Number of Cys residues: 5 Percentage of Cys residues: 2.02 %

>RC2754B.LRH_1|79:190 tid:423219 alias: stage:protein purification fragment|79:190 CP Pir/Fasta DEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRC PYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANG CDS cDNA 336 bp 1 gatgaagatc tggaagagct ttgtcccgtg tgtggagata aagtgtctgg gtaccattat 60 61 gggctcctca cctgtgaaag ctgcaaggga ttttttaagc gaacagtcca aaataataaa 120 121 aggtacacat gtatagaaaa ccagaactgc caaattgaca aaacacagag aaagcgttgt 180 181 ccttactgtc gttttcaaaa atgtctaagt gttggaatga agctagaagc tgtaagggcc 240 241 gaccgaatgc gtggaggaag gaataagttt gggccaatgt acaagagaga cagggccctg 300 301 aagcaacaga aaaaagccct catccgagcc aatgga 336 Residues: 112 aa Molecule Weight: 13034.49 Dalton Number of Met residues: 3 Percentage of Met residues: 2.68 % Number of Cys residues: 9 Percentage of Cys residues: 8.04 %

>RC2754B.LRH_1|191:541 tid:423220 alias: stage:protein purification fragment|191:541 CP Pir/Fasta LKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMP PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLK CEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELK VDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSH AQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYP QQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA CDS cDNA 1053 bp 1 cttaagctag aagccatgtc tcaggtgatc caagctatgc cctctgacct gaccatttcc 60 61 tctgcaattc aaaacatcca ctctgcctcc aaaggcctac ctctgaacca tgctgccttg 120 121 cctcctacag actatgacag aagtcccttt gtaacatccc ccattagcat gacaatgccc 180 181 cctcacggca gcctgcaagg ttaccaaaca tatggccact ttcctagccg ggccatcaag 240 241 tctgagtacc cagaccccta taccagctca cccgagtcca taatgggcta ttcatatatg 300 301 gatagttacc agacgagctc tccagcaagc atcccacatc tgatactgga acttttgaag 360 361 tgtgagccag atgagcctca agtccaggct aaaatcatgg cctatttgca gcaagagcag 420 421 gctaaccgaa gcaagcacga aaagctgagc acctttgggc ttatgtgcaa aatggcagat 480 481 caaactctct tctccattgt cgagtgggcc aggagtagta tcttcttcag agaacttaag 540 541 gttgatgacc aaatgaagct gcttcagaac tgctggagtg agctcttaat cctcgaccac 600 601 atttaccgac aagtggtaca tggaaaggaa ggatccatct tcctggttac tgggcaacaa 660 661 gtggactatt ccataatagc atcacaagcc ggagccaccc tcaacaacct catgagtcat 720 721 gcacaggagt tagtggcaaa acttcgttct ctccagtttg atcaacgaga gttcgtatgt 780 781 ctgaaattct tggtgctctt tagtttagat gtcaaaaacc ttgaaaactt ccagctggta 840 841 gaaggtgtcc aggaacaagt caatgccgcc ctgctggact acacaatgtg taactacccg 900 901 cagcagacag agaaatttgg acagctactt cttcgactac ccgaaatccg ggccatcagt 960 961 atgcaggctg aagaatacct ctactacaag cacctgaacg gggatgtgcc ctataataac 1020 1021 cttctcattg aaatgttgca tgccaaaaga gca 1053 Residues: 351 aa Molecule Weight: 39879.66 Dalton Number of Met residues: 14 Percentage of Met residues: 3.99 % Number of Cys residues: 5 Percentage of Cys residues: 1.42 %

>RC2754B.LRH_1|294:541 tid:430173 alias: stage:protein purification fragment|294:541 CP Pir/Fasta QTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTL FSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY SIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGV QEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLI EMLHAKRA CDS cDNA 744 bp 1 cagacgagct ctccagcaag catcccacat ctgatactgg aacttttgaa gtgtgagcca 60 61 gatgagcctc aagtccaggc taaaatcatg gcctatttgc agcaagagca ggctaaccga 120 121 agcaagcacg aaaagctgag cacctttggg cttatgtgca aaatggcaga tcaaactctc 180 181 ttctccattg tcgagtgggc caggagtagt atcttcttca gagaacttaa ggttgatgac 240 241 caaatgaagc tgcttcagaa ctgctggagt gagctcttaa tcctcgacca catttaccga 300 301 caagtggtac atggaaagga aggatccatc ttcctggtta ctgggcaaca agtggactat 360 361 tccataatag catcacaagc cggagccacc ctcaacaacc tcatgagtca tgcacaggag 420 421 ttagtggcaa aacttcgttc tctccagttt gatcaacgag agttcgtatg tctgaaattc 480 481 ttggtgctct ttagtttaga tgtcaaaaac cttgaaaact tccagctggt agaaggtgtc 540 541 caggaacaag tcaatgccgc cctgctggac tacacaatgt gtaactaccc gcagcagaca 600 601 gagaaatttg gacagctact tcttcgacta cccgaaatcc gggccatcag tatgcaggct 660 661 gaagaatacc tctactacaa gcacctgaac ggggatgtgc cctataataa ccttctcatt 720 721 gaaatgttgc atgccaaaag agca 744 Residues: 248 aa Molecule Weight: 28598.60 Dalton Number of Met residues: 8 Percentage of Met residues: 3.23 % Number of Cys residues: 5 Percentage of Cys residues: 2.02 %

>RC2754B.LRH_1|78:541 tid:430681 alias: stage:plasmid purification fragment|78:541 CP Pir/Fasta YDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKR CPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMS QVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQG YQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQ VQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKL LQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAK LRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFG QLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA CDS cDNA 1392 bp 1 tatgatgaag atctggaaga gctttgtccc gtgtgtggag ataaagtgtc tgggtaccat 60 61 tatgggctcc tcacctgtga aagctgcaag ggatttttta agcgaacagt ccaaaataat 120 121 aaaaggtaca catgtataga aaaccagaac tgccaaattg acaaaacaca gagaaagcgt 180 181 tgtccttact gtcgttttca aaaatgtcta agtgttggaa tgaagctaga agctgtaagg 240 241 gccgaccgaa tgcgtggagg aaggaataag tttgggccaa tgtacaagag agacagggcc 300 301 ctgaagcaac agaaaaaagc cctcatccga gccaatggac ttaagctaga agccatgtct 360 361 caggtgatcc aagctatgcc ctctgacctg accatttcct ctgcaattca aaacatccac 420 421 tctgcctcca aaggcctacc tctgaaccat gctgccttgc ctcctacaga ctatgacaga 480 481 agtccctttg taacatcccc cattagcatg acaatgcccc ctcacggcag cctgcaaggt 540 541 taccaaacat atggccactt tcctagccgg gccatcaagt ctgagtaccc agacccctat 600 601 accagctcac ccgagtccat aatgggctat tcatatatgg atagttacca gacgagctct 660 661 ccagcaagca tcccacatct gatactggaa cttttgaagt gtgagccaga tgagcctcaa 720 721 gtccaggcta aaatcatggc ctatttgcag caagagcagg ctaaccgaag caagcacgaa 780 781 aagctgagca cctttgggct tatgtgcaaa atggcagatc aaactctctt ctccattgtc 840 841 gagtgggcca ggagtagtat cttcttcaga gaacttaagg ttgatgacca aatgaagctg 900 901 cttcagaact gctggagtga gctcttaatc ctcgaccaca tttaccgaca agtggtacat 960 961 ggaaaggaag gatccatctt cctggttact gggcaacaag tggactattc cataatagca 1020 1021 tcacaagccg gagccaccct caacaacctc atgagtcatg cacaggagtt agtggcaaaa 1080 1081 cttcgttctc tccagtttga tcaacgagag ttcgtatgtc tgaaattctt ggtgctcttt 1140 1141 agtttagatg tcaaaaacct tgaaaacttc cagctggtag aaggtgtcca ggaacaagtc 1200 1201 aatgccgccc tgctggacta cacaatgtgt aactacccgc agcagacaga gaaatttgga 1260 1261 cagctacttc ttcgactacc cgaaatccgg gccatcagta tgcaggctga agaatacctc 1320 1321 tactacaagc acctgaacgg ggatgtgccc tataataacc ttctcattga aatgttgcat 1380 1381 gccaaaagag ca 1392 Residues: 464 aa Molecule Weight: 53059.30 Dalton Number of Met residues: 17 Percentage of Met residues: 3.66 % Number of Cys residues: 14 Percentage of Cys residues: 3.02 %

>RC2754B.LRH_1|78:541 tid:430676 alias: stage:proposed target fragment|78:541 CP Pir/Fasta YDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKR CPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMS QVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQG YQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQ VQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKL LQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAK LRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFG QLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA CDS cDNA 1392 bp 1 tatgatgaag atctggaaga gctttgtccc gtgtgtggag ataaagtgtc tgggtaccat 60 61 tatgggctcc tcacctgtga aagctgcaag ggatttttta agcgaacagt ccaaaataat 120 121 aaaaggtaca catgtataga aaaccagaac tgccaaattg acaaaacaca gagaaagcgt 180 181 tgtccttact gtcgttttca aaaatgtcta agtgttggaa tgaagctaga agctgtaagg 240 241 gccgaccgaa tgcgtggagg aaggaataag tttgggccaa tgtacaagag agacagggcc 300 301 ctgaagcaac agaaaaaagc cctcatccga gccaatggac ttaagctaga agccatgtct 360 361 caggtgatcc aagctatgcc ctctgacctg accatttcct ctgcaattca aaacatccac 420 421 tctgcctcca aaggcctacc tctgaaccat gctgccttgc ctcctacaga ctatgacaga 480 481 agtccctttg taacatcccc cattagcatg acaatgcccc ctcacggcag cctgcaaggt 540 541 taccaaacat atggccactt tcctagccgg gccatcaagt ctgagtaccc agacccctat 600 601 accagctcac ccgagtccat aatgggctat tcatatatgg atagttacca gacgagctct 660 661 ccagcaagca tcccacatct gatactggaa cttttgaagt gtgagccaga tgagcctcaa 720 721 gtccaggcta aaatcatggc ctatttgcag caagagcagg ctaaccgaag caagcacgaa 780 781 aagctgagca cctttgggct tatgtgcaaa atggcagatc aaactctctt ctccattgtc 840 841 gagtgggcca ggagtagtat cttcttcaga gaacttaagg ttgatgacca aatgaagctg 900 901 cttcagaact gctggagtga gctcttaatc ctcgaccaca tttaccgaca agtggtacat 960 961 ggaaaggaag gatccatctt cctggttact gggcaacaag tggactattc cataatagca 1020 1021 tcacaagccg gagccaccct caacaacctc atgagtcatg cacaggagtt agtggcaaaa 1080 1081 cttcgttctc tccagtttga tcaacgagag ttcgtatgtc tgaaattctt ggtgctcttt 1140 1141 agtttagatg tcaaaaacct tgaaaacttc cagctggtag aaggtgtcca ggaacaagtc 1200 1201 aatgccgccc tgctggacta cacaatgtgt aactacccgc agcagacaga gaaatttgga 1260 1261 cagctacttc ttcgactacc cgaaatccgg gccatcagta tgcaggctga agaatacctc 1320 1321 tactacaagc acctgaacgg ggatgtgccc tataataacc ttctcattga aatgttgcat 1380 1381 gccaaaagag ca 1392 Residues: 464 aa Molecule Weight: 53059.30 Dalton Number of Met residues: 17 Percentage of Met residues: 3.66 % Number of Cys residues: 14 Percentage of Cys residues: 3.02 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu