LOADING...
   13422365;PC07372D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
13422365    Target Constructs

Accession: 13422365
Local acc: PC07372D
Description: gi|13422365|gb|AAK23049.1| hypothetical protein [Caulobacter crescentus]
Organism: CAULOBACTER CRESCENTUS
Residues: 109 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>PC07372D|1:109 tid:361201 alias: stage:pdb deposition(pdb id:4GOQ) Full|1:109 CP Pir/Fasta
MLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTARLFSEATRGDGE
RFWMQPVRSTFEPDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVES
CDS  cDNA 327 bp
   1 atgcttcttt cgacggatat ctgggtcgcg gcgctgatcc gccgggccga actgggcggg    60
  61 gccttcgcta cggtcgctcg caagggtgac gcgcgcgccg gcgcggttct ggtcaaggcg   120
 121 gtcgatcgcc gggaggggac cgcgcgcctg ttcagcgagg cgacgcgcgg agacggcgag   180
 181 cgcttttgga tgcagcctgt gcgctcgacc ttcgagccgg atctggacgc ctacgccgag   240
 241 cgcgccgcgc gtatcgaccc ggatatctgg gtggtcgaga tcgaggatcg cgacggtcgc   300
 301 cattttctga ccgagccggt tgagtcc   327

Residues: 109 aa
Molecule Weight: 12188.04 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.83 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu