LOADING...
   104161995;ME9797A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
104161995    Target Constructs

Accession: 104161995
Local acc: ME9797A
Description: gi|104161995|emb|CAJ75704.1| predicted HD superfamily hydrolase [uncultured Thermotogales bacterium]
Organism: uncultured Thermotogales bacterium
Residues: 219 aa
Constructs: 1
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>ME9797A|1:219 tid:371986 alias: stage:pdb deposition(pdb id:2PQ7) Full|1:219 CP Pir/Fasta
MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIASREKCDLQKAII
AALLHDIKRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAIRSHRYSGGLTPT
SLTGKILQDADRLDAIGAVAIARVFSYSGKTGTPLHSLQFSPRSSYSGNSRSSINHFHEK
ILKIRPETFWTETARKMAEDRYSFVVEFVQRFLAEWGQI
CDS  cDNA 657 bp
   1 atgaatctta cagagcttat ggaacgcatt ccacatttga gagaaatcct caacatcgtt    60
  61 agggaagcct tcaaagacta tgatgaccct gctcatgata tttcgcacac tttcagggta   120
 121 atggagaatg cgagcgaaat agcttctcgg gagaagtgtg accttcaaaa ggcgataata   180
 181 gccgcactac ttcatgacat aaagaggcct cacgaagctc ttaccggagt cgatcatgct   240
 241 gaatccggtg cggaatatgc ttcaggactt ctaccgacaa tgggttttga catttcgttt   300
 301 gtcgcggaag tctcaaaggc tattaggtct cacagatact ccggtggctt aacacctacc   360
 361 agtctgacgg gaaagatcct ccaggatgca gacagactag acgcaatagg tgcggtagcg   420
 421 atagcaagag tcttttccta ttccggaaag accggaactc ctcttcactc tctccaattc   480
 481 agtccgcgca gctcttatag cggcaattcg cgtagttcta taaatcactt tcacgagaag   540
 541 atacttaaga taagaccgga gactttctgg acggaaactg caagaaaaat ggctgaggac   600
 601 cgctacagtt tcgttgtgga atttgtgcag aggttcctag ccgaatgggg acaaatc   657

Residues: 219 aa
Molecule Weight: 24633.54 Dalton
Number of Met residues: 5
Percentage of Met residues: 2.28 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu