LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query ZP_02072838.1 (session:13609849)
CLUSTAL W (1.83) multiple sequence alignment


ZP_02072838.1               MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDL
SP13297C.22_130.417916      ---------------------QNVPEGVIGAFKEGNSQELNKYLGDKVDL
SP13297C.1_130.409388       MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDL
                                                 *****************************

ZP_02072838.1               IIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMT
SP13297C.22_130.417916      IIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMT
SP13297C.1_130.409388       IIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMT
                            **************************************************

ZP_02072838.1               ANGNFRVNCFFRKVQNKYVIHQIRIDKTDE
SP13297C.22_130.417916      ANGNFRVNCFFRKVQNKYVIHQIRIDKTDE
SP13297C.1_130.409388       ANGNFRVNCFFRKVQNKYVIHQIRIDKTDE
                            ******************************
Contact Webmaster JCSG Menu