LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query ZP_02069929.1 (session:13609852)
CLUSTAL W (1.83) multiple sequence alignment


ZP_02069929.1               MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSV
SP13538A.21_135.417932      --------------------CMNGGGDLAGKWQLRQYQYADGTSEKVDSV
SP13538A.1_135.409405       MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSV
                                                ******************************

ZP_02069929.1               FYNFQKGSFSAICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDT
SP13538A.21_135.417932      FYNFQKGSFSAICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDT
SP13538A.1_135.409405       FYNFQKGSFSAICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDT
                            **************************************************

ZP_02069929.1               YFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF
SP13538A.21_135.417932      YFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF
SP13538A.1_135.409405       YFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF
                            ***********************************
Contact Webmaster JCSG Menu