LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query ZP_02066560.1 (session:13609843)
CLUSTAL W (1.83) multiple sequence alignment


ZP_02066560.1              MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMD
SP8524C.27_380.416724      --------------------------NDLLEPKVYFESKEYNFSVEDEMD
SP8524C.1_380.408069       MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMD
                                                     ************************

ZP_02066560.1              VMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVK
SP8524C.27_380.416724      VMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVK
SP8524C.1_380.408069       VMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVK
                           **************************************************

ZP_02066560.1              LSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVSTLSG
SP8524C.27_380.416724      LSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVSTLSG
SP8524C.1_380.408069       LSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVSTLSG
                           **************************************************

ZP_02066560.1              TNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFL
SP8524C.27_380.416724      TNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFL
SP8524C.1_380.408069       TNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFL
                           **************************************************

ZP_02066560.1              DNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYH
SP8524C.27_380.416724      DNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYH
SP8524C.1_380.408069       DNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYH
                           **************************************************

ZP_02066560.1              VALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG
SP8524C.27_380.416724      VALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG
SP8524C.1_380.408069       VALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG
                           **************************************************

ZP_02066560.1              ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQE
SP8524C.27_380.416724      ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQE
SP8524C.1_380.408069       ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQE
                           **************************************************

ZP_02066560.1              GGVIKDATGRINGTTNGITIKTLDAPIAIN
SP8524C.27_380.416724      GGVIKDATGRINGTTNGITIKTLDAPIAIN
SP8524C.1_380.408069       GGVIKDATGRINGTTNGITIKTLDAPIAIN
                           ******************************
Contact Webmaster JCSG Menu