LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query ZP_02030716.1 (session:13795967)
CLUSTAL W (1.83) multiple sequence alignment


ZP_02030716.1               MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVIL
SP16962B.29_256.419167      ----------------------------AVKENTSVHAPKINLKKDCVIL
SP16962B.1_256.412823       MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVIL
                                                        **********************

ZP_02030716.1               FQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNR
SP16962B.29_256.419167      FQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNR
SP16962B.1_256.412823       FQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNR
                            **************************************************

ZP_02030716.1               GISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVETY
SP16962B.29_256.419167      GISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVETY
SP16962B.1_256.412823       GISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVETY
                            **************************************************

ZP_02030716.1               ENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSA
SP16962B.29_256.419167      ENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSA
SP16962B.1_256.412823       ENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSA
                            **************************************************

ZP_02030716.1               RKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWM
SP16962B.29_256.419167      RKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWM
SP16962B.1_256.412823       RKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWM
                            **************************************************

ZP_02030716.1               EATGLK
SP16962B.29_256.419167      EATGLK
SP16962B.1_256.412823       EATGLK
                            ******
Contact Webmaster JCSG Menu