LOADING...
   YP_098753.1;SP13297E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query YP_098753.1 (session:13609834)
CLUSTAL W (1.83) multiple sequence alignment


YP_098753.1                 MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNL
SP13297E.22_130.418300      ---------------------QDIPVGVVVAFKKGNSQELNRYLGEKVNL
SP13297E.1_130.407827       MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNL
                                                 *****************************

YP_098753.1                 VIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTT
SP13297E.22_130.418300      VIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTT
SP13297E.1_130.407827       VIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTT
                            **************************************************

YP_098753.1                 ANGNFRINCFFRRVQNKYLINQIRIDKTNE
SP13297E.22_130.418300      ANGNFRINCFFRRVQNKYLINQIRIDKTNE
SP13297E.1_130.407827       ANGNFRINCFFRRVQNKYLINQIRIDKTNE
                            ******************************
Contact Webmaster JCSG Menu