LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query YP_094990.1 (session:13609840)
CLUSTAL W (1.83) multiple sequence alignment


YP_094990.1                 MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEIT
SP19432A.20_392.418834      -------------------FTLPRQPTKAYECENCSQLSRENLHDKWEIT
SP19432A.1_392.412258       MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEIT
                                               *******************************

YP_094990.1                 NEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKS
SP19432A.20_392.418834      NEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKS
SP19432A.1_392.412258       NEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKS
                            **************************************************

YP_094990.1                 IPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELG
SP19432A.20_392.418834      IPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELG
SP19432A.1_392.412258       IPELLIKTPKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELG
                            **************************************************

YP_094990.1                 YGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKAT
SP19432A.20_392.418834      YGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKAT
SP19432A.1_392.412258       YGKFILKSKDITNKYADAYMISVLDKFSITYLEVETDSLHYQYGDKLKAT
                            **************************************************

YP_094990.1                 ISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELN
SP19432A.20_392.418834      ISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELN
SP19432A.1_392.412258       ISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFEGTATLDSELN
                            **************************************************

YP_094990.1                 DRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
SP19432A.20_392.418834      DRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
SP19432A.1_392.412258       DRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
                            **************************************************

YP_094990.1                 FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFT
SP19432A.20_392.418834      FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFT
SP19432A.1_392.412258       FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFT
                            **************************************************

YP_094990.1                 FDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD
SP19432A.20_392.418834      FDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD
SP19432A.1_392.412258       FDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD
                            ******************************************
Contact Webmaster JCSG Menu