LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query YP_001337146.1 (session:13609854)
CLUSTAL W (1.83) multiple sequence alignment


YP_001337146.1              MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPV
SP18574A.26_101.418471      -------------------------VEETTPQNMTCQEFMDMNPKSMTPV
SP18574A.1_101.411737       MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPV
                                                     *************************

YP_001337146.1              AFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIK
SP18574A.26_101.418471      AFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIK
SP18574A.1_101.411737       AFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIK
                            **************************************************

YP_001337146.1              K
SP18574A.26_101.418471      K
SP18574A.1_101.411737       K
                            *
Contact Webmaster JCSG Menu