LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
Multiple alignments of query TM0828 (session:13288269)
CLUSTAL W (1.83) multiple sequence alignment


TM0828                   MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
TM0828.1_319.282698      MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
                         ************************************************************

TM0828                   FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
TM0828.1_319.282698      FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
                         ************************************************************

TM0828                   VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
TM0828.1_319.282698      VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
                         ************************************************************

TM0828                   EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
TM0828.1_319.282698      EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
                         ************************************************************

TM0828                   GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
TM0828.1_319.282698      GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
                         ************************************************************

TM0828                   PDLEAIKKEYDHFTVERVK
TM0828.1_319.282698      PDLEAIKKEYDHFTVERVK
                         *******************
Contact Webmaster JCSG Menu